Potri.007G120501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22060 271 / 6e-92 Receptor-like protein kinase-related family protein (.1)
AT3G58310 226 / 4e-74 Domain of unknown function (DUF26) (.1)
AT3G21990 176 / 9e-55 Domain of unknown function (DUF26) (.1)
AT4G20670 172 / 9e-53 Domain of unknown function (DUF26) (.1)
AT2G31620 155 / 1e-46 Receptor-like protein kinase-related family protein (.1)
AT4G20640 159 / 5e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20620 159 / 5e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20610 159 / 5e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20570 159 / 5e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20580 159 / 5e-46 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G120500 421 / 2e-151 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1)
Potri.007G120700 417 / 5e-150 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1)
Potri.007G120401 410 / 3e-147 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120400 409 / 9e-147 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1)
Potri.017G040450 375 / 2e-133 AT3G22060 274 / 4e-93 Receptor-like protein kinase-related family protein (.1)
Potri.017G039966 374 / 1e-132 AT3G22060 273 / 5e-93 Receptor-like protein kinase-related family protein (.1)
Potri.017G040049 268 / 1e-90 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1)
Potri.007G120300 266 / 4e-90 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1)
Potri.007G120600 263 / 5e-89 AT3G22060 214 / 2e-69 Receptor-like protein kinase-related family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027145 253 / 1e-84 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1)
Lus10039699 165 / 5e-50 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1)
Lus10007632 171 / 6e-49 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10018382 165 / 5e-47 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Lus10038227 156 / 8e-47 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1)
Lus10018380 157 / 2e-45 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10025875 147 / 3e-43 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1)
Lus10018377 146 / 5e-40 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10018379 133 / 2e-35 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10007634 132 / 2e-35 AT4G23160 417 / 1e-137 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Potri.007G120501.1 pacid=42766373 polypeptide=Potri.007G120501.1.p locus=Potri.007G120501 ID=Potri.007G120501.1.v4.1 annot-version=v4.1
ATGTCTTTCTCCAACTTCGCCTCCTTTCTATGTCTATTAGCCTTCTCTCTCCTTGTCCACACTGGTTTAATTGGAGCTGACCCACTTTACCATTTCTGTT
CAACTCCTGAGAACTTCACCGCCAATGGCCCTTATGAATCCAACCTAAACAAGCTTACTAGTTACCTCTACTATCAAGCCCCTCGTAAAGGATTTGGTCT
GTGTTCAAAAGGCCACAAGCCGGACCAAGCATATGGGCTCGCTCTTTGTAGAGGTGACGCCTCAACCTCAGATTGCAAGACCTGTGTTGTTGAGGCAGGC
GGTGAGATTCGAAAGCGCTGTCCATACAATAAAGCGGCCATCATTTGGTATGATAACTGTCTTCTGAAGTACTCAAACAATGGATTCTTTGGCCAGATTG
ATTATAGAAACAAGTTCTATCTGTGGAACGTGAAAGTTGTAAGGGAACCAGTTACATTCAACGGAAAGACCAAAGAGCTTTTGACCCAGCTTGCCAATAA
AGTTCAAGCAACCCCCAAGTTGTACGCAACAGGAGTGATGGAGCTAGGAGAATCAACCAAGATATATGGCTTGGTCCAGTGCACTCGGGATCTTTCTAGT
GCTGTCTGTAAGAAATGCCTCGATGGTATAATCGGTGAACTTCCAAGCTGCTATGACGGGAAAGAAGGTGGCAGAGTTATCGGTGGGAGTTGCAATTTCA
GATATGAAATATACCCTTTTGTCAATGCTTAA
AA sequence
>Potri.007G120501.1 pacid=42766373 polypeptide=Potri.007G120501.1.p locus=Potri.007G120501 ID=Potri.007G120501.1.v4.1 annot-version=v4.1
MSFSNFASFLCLLAFSLLVHTGLIGADPLYHFCSTPENFTANGPYESNLNKLTSYLYYQAPRKGFGLCSKGHKPDQAYGLALCRGDASTSDCKTCVVEAG
GEIRKRCPYNKAAIIWYDNCLLKYSNNGFFGQIDYRNKFYLWNVKVVREPVTFNGKTKELLTQLANKVQATPKLYATGVMELGESTKIYGLVQCTRDLSS
AVCKKCLDGIIGELPSCYDGKEGGRVIGGSCNFRYEIYPFVNA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22060 Receptor-like protein kinase-r... Potri.007G120501 0 1
AT2G41290 SSL2 strictosidine synthase-like 2 ... Potri.016G037700 4.24 0.8390
AT3G22060 Receptor-like protein kinase-r... Potri.007G120400 5.09 0.7827
AT4G37770 ACS8 1-amino-cyclopropane-1-carboxy... Potri.014G012600 8.36 0.7889 ACS1.2,ACS4
AT3G52480 unknown protein Potri.016G071700 9.79 0.7830
AT2G30100 pentatricopeptide (PPR) repeat... Potri.009G075200 10.09 0.7765
AT5G11070 unknown protein Potri.003G070750 10.09 0.8094
AT3G08760 ATSIK Protein kinase superfamily pro... Potri.006G108200 14.42 0.7613
AT4G32330 TPX2 (targeting protein for Xk... Potri.018G027500 17.34 0.8051
AT3G61980 serine protease inhibitor, Kaz... Potri.014G108700 24.49 0.7632
AT1G14190 Glucose-methanol-choline (GMC)... Potri.010G168200 25.69 0.7717

Potri.007G120501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.