Potri.007G120601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22060 199 / 8e-65 Receptor-like protein kinase-related family protein (.1)
AT3G58310 165 / 3e-51 Domain of unknown function (DUF26) (.1)
AT2G31620 143 / 1e-42 Receptor-like protein kinase-related family protein (.1)
AT3G21990 136 / 4e-40 Domain of unknown function (DUF26) (.1)
AT4G20670 134 / 8e-39 Domain of unknown function (DUF26) (.1)
AT5G48540 121 / 3e-34 receptor-like protein kinase-related family protein (.1)
AT4G05200 127 / 4e-34 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT3G21960 120 / 1e-33 Receptor-like protein kinase-related family protein (.1.2)
AT3G21910 118 / 9e-33 Domain of unknown function (DUF26) (.1)
AT3G21970 117 / 2e-32 Domain of unknown function (DUF26) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G120600 353 / 8e-126 AT3G22060 214 / 2e-69 Receptor-like protein kinase-related family protein (.1)
Potri.007G120300 352 / 5e-125 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1)
Potri.017G040049 268 / 9e-92 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1)
Potri.017G040300 264 / 2e-90 AT3G22060 226 / 3e-74 Receptor-like protein kinase-related family protein (.1)
Potri.007G120401 231 / 2e-77 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120400 230 / 5e-77 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120500 229 / 1e-76 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1)
Potri.007G120501 226 / 1e-75 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1)
Potri.017G040215 224 / 1e-75 AT3G22060 177 / 8e-56 Receptor-like protein kinase-related family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027145 182 / 3e-58 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1)
Lus10038227 133 / 1e-38 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1)
Lus10039699 131 / 1e-37 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1)
Lus10025875 128 / 6e-37 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1)
Lus10007632 133 / 2e-36 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10027144 120 / 4e-35 ND 121 / 1e-34
Lus10018377 127 / 3e-34 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10018382 124 / 2e-33 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Lus10018380 120 / 2e-32 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10026629 119 / 3e-31 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Potri.007G120601.1 pacid=42765888 polypeptide=Potri.007G120601.1.p locus=Potri.007G120601 ID=Potri.007G120601.1.v4.1 annot-version=v4.1
ATGAGGTTAAGGGGTCAGAAAAACCTAGACCGACCATATGGGCTCGTTCTTTGCAGAGGAGATGTCTCATCCCCAGACTGCAGTGCCTGTGTTGCTGATG
CAACCAGGGAGATCCGCAAGCGCTGCCCATACGGTAAAAGTGGATTCATAGCTTACGATAACTGTCTACTGAAGTATTCAAACAAGGACTTCTTTGGCCA
GATTGACAGCCAAAACAAGATCTACTTGTATAACGTGCGAAATGTGAGCAATCCAGTGGTATTTAATCAGAAGACAAAGGACTTGTTGGGCCAACTGGCA
AACAAGGCTTATATCGCAAGGAAAATGTATGCCGCTGGAGAGTTGGGCCTTGGGGGATCGAAGAAACTTTACGGAATGGCTCAATGCACAAGGGATCTCT
CTAGTGCTAATTGTAAGAAGTGTCTTGATGGTGCTATAAGTGAGCTTCAAGGTTTTGCTGGTGGAAAAGAAGGGGGTAGGGTTACTGGTGGGAGTTGTAC
GGTTAGATATGAGATTTATCCATTTGTTAAAGCTTAA
AA sequence
>Potri.007G120601.1 pacid=42765888 polypeptide=Potri.007G120601.1.p locus=Potri.007G120601 ID=Potri.007G120601.1.v4.1 annot-version=v4.1
MRLRGQKNLDRPYGLVLCRGDVSSPDCSACVADATREIRKRCPYGKSGFIAYDNCLLKYSNKDFFGQIDSQNKIYLYNVRNVSNPVVFNQKTKDLLGQLA
NKAYIARKMYAAGELGLGGSKKLYGMAQCTRDLSSANCKKCLDGAISELQGFAGGKEGGRVTGGSCTVRYEIYPFVKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22060 Receptor-like protein kinase-r... Potri.007G120601 0 1
AT3G22060 Receptor-like protein kinase-r... Potri.007G120600 1.00 0.9756
AT5G05340 Peroxidase superfamily protein... Potri.013G154400 2.44 0.9481 Pt-PRX1.9
AT3G22060 Receptor-like protein kinase-r... Potri.007G120300 2.82 0.9648
AT4G21895 DNA binding (.1) Potri.011G001901 3.46 0.9473
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Potri.011G030650 7.93 0.8911
Potri.008G042900 8.06 0.8553
AT2G34930 disease resistance family prot... Potri.001G262800 8.36 0.9332
AT4G27290 S-locus lectin protein kinase ... Potri.011G125851 9.59 0.8899
AT4G20820 FAD-binding Berberine family p... Potri.011G162968 10.58 0.9139
AT1G17860 Kunitz family trypsin and prot... Potri.017G153600 11.95 0.9049

Potri.007G120601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.