Potri.007G120700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22060 274 / 3e-93 Receptor-like protein kinase-related family protein (.1)
AT3G58310 236 / 3e-78 Domain of unknown function (DUF26) (.1)
AT3G21990 166 / 9e-51 Domain of unknown function (DUF26) (.1)
AT4G20670 162 / 4e-49 Domain of unknown function (DUF26) (.1)
AT2G31620 159 / 3e-48 Receptor-like protein kinase-related family protein (.1)
AT3G21960 156 / 9e-47 Receptor-like protein kinase-related family protein (.1.2)
AT4G20640 153 / 1e-43 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20620 153 / 1e-43 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20610 153 / 1e-43 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
AT4G20570 153 / 1e-43 Protein with domains of unknown function (DUF26 and DUF1204) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G120500 461 / 2e-167 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1)
Potri.007G120401 427 / 5e-154 AT3G22060 271 / 3e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120400 426 / 2e-153 AT3G22060 270 / 8e-92 Receptor-like protein kinase-related family protein (.1)
Potri.007G120501 417 / 1e-149 AT3G22060 271 / 4e-92 Receptor-like protein kinase-related family protein (.1)
Potri.017G040450 394 / 1e-140 AT3G22060 274 / 4e-93 Receptor-like protein kinase-related family protein (.1)
Potri.017G039966 389 / 5e-139 AT3G22060 273 / 5e-93 Receptor-like protein kinase-related family protein (.1)
Potri.017G040049 276 / 7e-94 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1)
Potri.007G120300 266 / 3e-90 AT3G22060 194 / 1e-61 Receptor-like protein kinase-related family protein (.1)
Potri.017G040300 266 / 4e-90 AT3G22060 226 / 3e-74 Receptor-like protein kinase-related family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027145 260 / 1e-87 AT3G22060 253 / 8e-85 Receptor-like protein kinase-related family protein (.1)
Lus10039699 169 / 1e-51 AT3G22060 171 / 5e-52 Receptor-like protein kinase-related family protein (.1)
Lus10018382 175 / 2e-50 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Lus10007632 173 / 7e-50 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10038227 163 / 3e-49 AT5G48540 261 / 1e-87 receptor-like protein kinase-related family protein (.1)
Lus10018380 156 / 4e-45 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10025875 150 / 1e-44 AT5G48540 261 / 2e-87 receptor-like protein kinase-related family protein (.1)
Lus10018377 147 / 2e-40 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10007634 136 / 1e-36 AT4G23160 417 / 1e-137 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
Lus10018379 136 / 2e-36 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Potri.007G120700.1 pacid=42766775 polypeptide=Potri.007G120700.1.p locus=Potri.007G120700 ID=Potri.007G120700.1.v4.1 annot-version=v4.1
ATGTCTTCCTCCAACTTCGCCTCCTTTCTATGTCTATTAGCCTTTTCTCTCCTTGTCCACACTGGATTTGGAGCTGACCCACTTTTCCACTTCTGTTCAA
CTCCTGAGAACTTCACTGCCAATGGCCCCTATGAATCCAACCTAAACAAGCTTACTAGTTACCTCTACTATCAAGCCCCTAGTACAGGATTTGGTCTGGG
TTCAATAGGCCAGAACCCGGACCAAGCATATGGGCTTGCTCTTTGTAGAGGTGACGCCTCAACCTCAGATTGCAAGACCTGTGTTGTTGAGGCAGGCGGT
GAGATTCGAAAGCGCTGTCCATACAATAAAGCGGCCATCATTTGGTATGATAACTGTCTTGTGAAGTACTCAAACAATGGATTCTTTGGCCAAATTGATA
ACGGAAACAAGTTCTATATGTGGAACGTGAAAGTTGTAAGTGAGCCAGTTACATTCAACGGAAAGACCAAAGAGCTTTTGACCCAGCTTGCCAATAAAGT
TGAAGCAACCCCCAAGTTGTACGAAACAGGAGAGATGGAGCTAGGAGAATCAACCAAGCTATATGGATTGGTCCAGTGCACTCGGGATCTTTCTAGTGCT
GTCTGTAAGAAATGCCTCGATGGTATAATCGGTGAACTTCCAAGCTGCTGTGATGGGAAAGAAGGTGGCAGAGTTGTCAGTGGGAGTTGCAATTTCAGAT
ATGAAATATGCCCTTTTGTCAATGCTTAA
AA sequence
>Potri.007G120700.1 pacid=42766775 polypeptide=Potri.007G120700.1.p locus=Potri.007G120700 ID=Potri.007G120700.1.v4.1 annot-version=v4.1
MSSSNFASFLCLLAFSLLVHTGFGADPLFHFCSTPENFTANGPYESNLNKLTSYLYYQAPSTGFGLGSIGQNPDQAYGLALCRGDASTSDCKTCVVEAGG
EIRKRCPYNKAAIIWYDNCLVKYSNNGFFGQIDNGNKFYMWNVKVVSEPVTFNGKTKELLTQLANKVEATPKLYETGEMELGESTKLYGLVQCTRDLSSA
VCKKCLDGIIGELPSCCDGKEGGRVVSGSCNFRYEICPFVNA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G22060 Receptor-like protein kinase-r... Potri.007G120700 0 1
AT3G22060 Receptor-like protein kinase-r... Potri.007G120500 2.44 0.8190
AT5G64700 nodulin MtN21 /EamA-like trans... Potri.011G148600 3.00 0.7707
AT3G45010 SCPL48 serine carboxypeptidase-like 4... Potri.004G215400 3.16 0.7922
AT5G20480 EFR EF-TU receptor (.1) Potri.005G031700 4.47 0.7255
AT3G22060 Receptor-like protein kinase-r... Potri.007G120401 7.74 0.6812
AT3G22060 Receptor-like protein kinase-r... Potri.007G120400 8.48 0.7039
AT4G06744 Leucine-rich repeat (LRR) fami... Potri.009G098700 8.48 0.7628
AT4G14010 RALFL32 ralf-like 32 (.1) Potri.017G059800 9.21 0.7529 RALFL32.1
AT1G54460 TPX2 (targeting protein for Xk... Potri.013G042800 11.31 0.7283
AT3G07490 AtCML3, AGD11 calmodulin-like 3, ARF-GAP dom... Potri.006G065900 11.61 0.6563 Pt-CBP1.3

Potri.007G120700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.