Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23170 85 / 7e-20 CRK9, EP1 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 9, receptor-like protein kinase-related family protein (.1) AT3G22060 83 / 2e-19 Receptor-like protein kinase-related family protein (.1) AT4G23160 83 / 2e-18 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G23180 81 / 8e-18 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G05200 78 / 1e-16 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT3G58310 74 / 5e-16 Domain of unknown function (DUF26) (.1) AT5G48540 72 / 3e-15 receptor-like protein kinase-related family protein (.1) AT4G23280 74 / 4e-15 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) AT4G23310 72 / 2e-14 CRK23 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) AT4G23150 71 / 2e-14 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G120900 [exp] 296 / 4e-97 AT4G23180 454 / 3e-151 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.017G040300 [exp] 91 / 3e-22 AT3G22060 226 / 3e-74 Receptor-like protein kinase-related family protein (.1) Potri.017G040049 [exp] 91 / 5e-22 AT3G22060 221 / 9e-72 Receptor-like protein kinase-related family protein (.1) Potri.011G028400 [exp] 93 / 7e-22 AT4G05200 709 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G026000 [exp] 91 / 2e-21 AT4G05200 353 / 3e-116 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G025001 [exp] 91 / 4e-21 AT4G05200 465 / 4e-158 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G024566 [exp] 87 / 1e-20 AT4G05200 177 / 7e-51 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.007G120500 [exp] 86 / 2e-20 AT3G22060 278 / 6e-95 Receptor-like protein kinase-related family protein (.1) Potri.007G120700 [exp] 86 / 2e-20 AT3G22060 275 / 2e-93 Receptor-like protein kinase-related family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031581 [exp] 139 / 2e-38 AT4G23310 213 / 2e-60 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10015091 [exp] 134 / 4e-36 AT5G54650 556 / 1e-178 FORMIN HOMOLOGY 5, formin homology5 (.1.2) Lus10015095 [exp] 132 / 1e-35 AT4G23310 220 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10015096 [exp] 124 / 4e-33 AT4G05200 234 / 7e-69 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10031580 [exp] 122 / 4e-32 AT4G23160 424 / 1e-139 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10031582 [exp] 117 / 1e-30 AT4G05200 436 / 6e-145 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10027146 [exp] 117 / 2e-30 AT4G23180 451 / 1e-150 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10015094 [exp] 114 / 3e-29 AT4G23160 432 / 7e-143 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) Lus10031578 [exp] 110 / 9e-28 AT4G23180 422 / 5e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10031579 [exp] 103 / 1e-25 AT4G23160 477 / 8e-154 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [poplar] [flax] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Potri.007G120800.2 pacid=42766082 polypeptide=Potri.007G120800.2.p locus=Potri.007G120800 ID=Potri.007G120800.2.v4.1 annot-version=v4.1 ATGTTAGATGCTGGTTTCTTACTCTTGGTTTCATGTATTCTTCATTTTTACTACCTTTCTAAAGGCCAAGAAGTTACATACTGTGATAATTCCATGAATT ACACTTCTGGGAGTGCCTATCAGCAGAACCTAAATCTTACCCTCACTTCATTAGCTGCAAATGCTTCTCTAACAGGGTACTATATCTCTACTGTGGGCCT GGGCCAGAACCCCAATCTGGTTTATGGCCTCAAAAACTGTCCAGGTTTTACCCCCAAGGAAGTTTGCCATGACTGTGCAAATTCTGTAGTTACAAAAATC ATCCAACGGTGTCCTAACCAGAAGGTTGCTTTTGTATTTAACGAGAGTTGTTTGCCACAGTACTCGGACTTGCCATTTTTCTCAACTGCTGACATTGTTA TAAAGCTTGTTTTTCTTAGCCCTCAGAATGCTGAAGACCCGGTTCTTTTCAGGAGCCAATTAGGAAGTTTGCTTGGGAACATCTCATCCAACGCTGCCGC TGATACTTCAAGATTAGCAGATGGAAGGACTAGTTACACAAGTTCTATTGATATATATGGTATGGCTCAGTGCACCAGAAACTTAACAGGAGATGAATGT TTACGCTGTCTTTGA
AA sequence Show only first row Show all	>Potri.007G120800.2 pacid=42766082 polypeptide=Potri.007G120800.2.p locus=Potri.007G120800 ID=Potri.007G120800.2.v4.1 annot-version=v4.1 MLDAGFLLLVSCILHFYYLSKGQEVTYCDNSMNYTSGSAYQQNLNLTLTSLAANASLTGYYISTVGLGQNPNLVYGLKNCPGFTPKEVCHDCANSVVTKI IQRCPNQKVAFVFNESCLPQYSDLPFFSTADIVIKLVFLSPQNAEDPVLFRSQLGSLLGNISSNAAADTSRLADGRTSYTSSIDIYGMAQCTRNLTGDEC LRCL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23170		CRK9, EP1	CYSTEINE-RICH RLK \(RECEPTOR-L...		Potri.007G120800 [exp]	0	1
AT4G18020	GARP	APRR2	PSEUDO-RESPONSE REGULATOR 2, C...		Potri.003G087700 [exp]	1.41	0.8914	PtpRR10
AT5G66770	GRAS		GRAS family transcription fact...		Potri.005G123800 [exp]	3.31	0.8375
AT3G50950		ZAR1	HOPZ-ACTIVATED RESISTANCE 1 (....		Potri.011G129800 [exp]	3.87	0.8673
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Potri.001G049100 [exp]	4.00	0.8686
					Potri.010G147200 [exp]	5.19	0.8697
					Potri.009G051100 [exp]	6.48	0.8355
AT2G38090	MYB	MYB-R	Duplicated homeodomain-like su...		Potri.016G112300 [exp]	6.92	0.8372
AT2G45960		PIP1;2, ATHH2, ...	TRANSMEMBRANE PROTEIN A, NAMED...		Potri.009G127900 [exp]	8.83	0.8659
AT3G54450			Major facilitator superfamily ...		Potri.001G027100 [exp]	12.00	0.8449
AT1G31490			HXXXD-type acyl-transferase fa...		Potri.001G128100 [exp]	12.24	0.8389

Compare expression of checked genes

Potri.007G120800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.