Potri.007G122401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
AT3G01190 370 / 6e-129 Peroxidase superfamily protein (.1)
AT1G05250 363 / 6e-126 Peroxidase superfamily protein (.1)
AT1G05240 363 / 6e-126 Peroxidase superfamily protein (.1)
AT1G05260 329 / 1e-112 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT4G11290 316 / 3e-107 Peroxidase superfamily protein (.1)
AT3G21770 306 / 2e-103 Peroxidase superfamily protein (.1)
AT5G64120 271 / 2e-89 Peroxidase superfamily protein (.1)
AT2G39040 263 / 4e-86 Peroxidase superfamily protein (.1)
AT2G41480 254 / 7e-83 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G122351 644 / 0 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122250 644 / 0 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122301 644 / 0 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122200 620 / 0 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
Potri.007G122451 600 / 0 AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
Potri.011G027300 362 / 2e-125 AT3G01190 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.019G063201 361 / 6e-125 AT3G01190 412 / 4e-145 Peroxidase superfamily protein (.1)
Potri.004G023200 343 / 3e-118 AT3G01190 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.004G023100 342 / 2e-117 AT3G01190 403 / 1e-141 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018374 376 / 8e-131 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1)
Lus10007638 367 / 2e-127 AT3G01190 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10006756 346 / 5e-119 AT3G01190 379 / 3e-132 Peroxidase superfamily protein (.1)
Lus10027164 339 / 3e-116 AT1G05260 463 / 3e-165 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10039680 334 / 3e-114 AT1G05260 458 / 3e-163 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10015127 330 / 8e-113 AT1G05260 444 / 7e-158 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10027163 328 / 5e-112 AT4G11290 491 / 4e-176 Peroxidase superfamily protein (.1)
Lus10039681 328 / 9e-112 AT4G11290 488 / 3e-175 Peroxidase superfamily protein (.1)
Lus10031548 326 / 4e-111 AT1G05260 441 / 1e-156 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10032926 270 / 4e-89 AT1G05260 292 / 5e-98 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.007G122401.1 pacid=42766662 polypeptide=Potri.007G122401.1.p locus=Potri.007G122401 ID=Potri.007G122401.1.v4.1 annot-version=v4.1
ATGGCTATTCAAAAGCTTTTCGCGGTCTGCTTTCTTCAACTCGTTTTCGCCTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGGCTGCAACTCGGATTCT
ACCAGAGAGCATGTCCTGATGCAGAGCTTATAGTCCATCAAACTCTTTATCGTTACGTCTCTAGGGACCGAACCCTTGCTGCTCCTCTGCTACGAATGCA
TTTCCATGATTGCTTTATCAGGGGATGTGAGGGTTCTGTGCTCCTAAGTTCTACAAAGAATAATCAAGCTGAGAAAGACGCCATCCCAAATAAAACCTTA
AGAGGGTTCAATGTCATTGATGCTGTAAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTGGTTTCCTGTGCCGATATCTTGGCCTTGGTTGCTCGTGACG
CGGTTCTAATGATTGGCGGACCACGTTGGGATGTTCCCACAGGACGCAGAGACGGAAGGGTGTCGATTGCCAACGAGGCTTTATTCAATTTACCATCTCC
TTTTGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAGGAGGACACACCATAGGAATTGGA
CACTGTACCATAATCTCGAACAGGTTGTACAATTTCACAGGCAAGGGAGATACTGACCCTTCATTGGACCCAAGATACGCTGCTCAACTGAAGAATAAAT
GTAAGCCTGGAAACTCCAACACAGTCGTTGAGATGGACCCTGGTAGCTTCAAGTCTTTCGACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCT
ATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACAAGAGGCTATGTCAAATTTCAGTCAATGACACAGGGATCCACTTTTGCACAAGATTTTGCT
GAATCCATGGTGAAAATGGGTTACATTGGAGTCCTGACCGGCGAACAAGGCGAAATCAGGAAACATTGTGCTGTTGTGAATTAA
AA sequence
>Potri.007G122401.1 pacid=42766662 polypeptide=Potri.007G122401.1.p locus=Potri.007G122401 ID=Potri.007G122401.1.v4.1 annot-version=v4.1
MAIQKLFAVCFLQLVFAFLLAGLTNAGGLQLGFYQRACPDAELIVHQTLYRYVSRDRTLAAPLLRMHFHDCFIRGCEGSVLLSSTKNNQAEKDAIPNKTL
RGFNVIDAVKSALEKKCPGVVSCADILALVARDAVLMIGGPRWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIG
HCTIISNRLYNFTGKGDTDPSLDPRYAAQLKNKCKPGNSNTVVEMDPGSFKSFDEDYYNIVAKRRGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFA
ESMVKMGYIGVLTGEQGEIRKHCAVVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G15180 Peroxidase superfamily protein... Potri.007G122401 0 1
AT5G15180 Peroxidase superfamily protein... Potri.007G122250 2.44 0.9986
AT5G15180 Peroxidase superfamily protein... Potri.007G122351 2.82 0.9960
AT5G15180 Peroxidase superfamily protein... Potri.007G122301 3.00 0.9978
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Potri.006G272500 4.00 0.9906
AT3G05640 Protein phosphatase 2C family ... Potri.010G006200 5.91 0.9925
AT2G38940 PHT1;4, ATPT2 ARABIDOPSIS THALIANA PHOSPHATE... Potri.010G072000 6.92 0.9855 Pt-PT2.8,PtrPHT1-1
AT3G01190 Peroxidase superfamily protein... Potri.019G063201 8.48 0.9866
AT5G15180 Peroxidase superfamily protein... Potri.007G122451 8.66 0.9835
AT3G02630 Plant stearoyl-acyl-carrier-pr... Potri.002G209602 9.38 0.9859
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Potri.006G248500 9.48 0.9862

Potri.007G122401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.