Potri.007G122451 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15180 374 / 3e-130 Peroxidase superfamily protein (.1)
AT3G01190 359 / 2e-124 Peroxidase superfamily protein (.1)
AT1G05250 358 / 7e-124 Peroxidase superfamily protein (.1)
AT1G05240 358 / 7e-124 Peroxidase superfamily protein (.1)
AT1G05260 326 / 4e-111 RCI3A, RCI3 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
AT4G11290 311 / 1e-105 Peroxidase superfamily protein (.1)
AT3G21770 304 / 1e-102 Peroxidase superfamily protein (.1)
AT5G64120 270 / 4e-89 Peroxidase superfamily protein (.1)
AT2G39040 254 / 8e-83 Peroxidase superfamily protein (.1)
AT2G41480 252 / 6e-82 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G122351 579 / 0 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122401 579 / 0 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122250 579 / 0 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122301 579 / 0 AT5G15180 396 / 9e-139 Peroxidase superfamily protein (.1)
Potri.007G122200 555 / 0 AT5G15180 395 / 2e-138 Peroxidase superfamily protein (.1)
Potri.011G027300 353 / 5e-122 AT3G01190 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.019G063201 352 / 3e-121 AT3G01190 412 / 4e-145 Peroxidase superfamily protein (.1)
Potri.004G023200 338 / 4e-116 AT3G01190 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.004G023100 337 / 1e-115 AT3G01190 403 / 1e-141 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018374 369 / 3e-128 AT3G01190 414 / 4e-146 Peroxidase superfamily protein (.1)
Lus10007638 364 / 3e-126 AT3G01190 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10006756 343 / 8e-118 AT3G01190 379 / 3e-132 Peroxidase superfamily protein (.1)
Lus10027164 333 / 8e-114 AT1G05260 463 / 3e-165 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10039680 331 / 3e-113 AT1G05260 458 / 3e-163 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10015127 324 / 1e-110 AT1G05260 444 / 7e-158 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10031548 323 / 5e-110 AT1G05260 441 / 1e-156 RARE COLD INDUCIBLE GENE 3, Peroxidase superfamily protein (.1)
Lus10039681 323 / 6e-110 AT4G11290 488 / 3e-175 Peroxidase superfamily protein (.1)
Lus10027163 319 / 1e-108 AT4G11290 491 / 4e-176 Peroxidase superfamily protein (.1)
Lus10021956 271 / 5e-88 AT2G39040 323 / 6e-108 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.007G122451.1 pacid=42765444 polypeptide=Potri.007G122451.1.p locus=Potri.007G122451 ID=Potri.007G122451.1.v4.1 annot-version=v4.1
ATGGCTGTTCAAAAGCTTTTCCCAGTCCTCTTTCTTCAACTAGCCCTTGCTTTTTTGCTTGCAGGCCTCACTAATGCAGGGGGTTTGCAACTCGGGTTCT
ACCAGGGAGCATGTCCTGATGCAGAGCTTATAGTCCATCAAACTCTTTACCGTTACATTTCTAGGGACCCAACCCTTGCTGCTCCTTTGCTGAGAATGCA
TTTCCATGATTGTTTCATCAGGGGATGTGAGGGTTCTGTGCTCCTAAGTTCTACAAAGAATAATCAAGCTGAGAAAGACGCCATCCCAAATAAAACCTTA
AGAGGGTTCAATGTCATTGATGCTGTAAAATCAGCACTAGAAAAGAAGTGTCCTGGTGTGGTTTCCTGTGCCGATATCTTGGCCTTGGTTGCTCGTGACG
CGGTTCTAATGATTGGCGGACCACGTTGGGATGTTCCCACAGGACGCAGAGACGGAAGGGTGTCGATTGCCAACGAGGCTTTATTCAATTTACCATCTCC
TTTTGCCAACATAACTGTCCTGAAACAACAATTTGCTGCAACGGGTTTAAGTGTAAAGGACCTTGCAGTTTTATCAGGAGGACACACCATAGGAATTGGA
CACTGTACCATAATCTCGAACAGGTTGTACAATTTCACAGGCAAGGGAGATACTGACCCTTCATTGGACCCAAGATACGCTGCTCAACTGAAGAATAAAT
GTAAGCCTGGAAACTCCAACACAGTCGTTGAGATGGACCCTGGTAGCTTCAAGTCTTTCGACGAAGATTACTACAACATTGTAGCTAAAAGAAGAGGGCT
ATTCCGATCTGATGCAGCTCTTCTTGACGATGCTGAAACAAGAGGCTATGTCAAATTTCAGTCAATGACACAGGGATCCACTTTTGCACAAGATTTTGCT
GAATCCATGGTGAAAATGGGTTACATTGGAGTCCTGACCGGCGAACAAGGCGAAATCAGGAAACATTGTGCTGTTGTGAATTAA
AA sequence
>Potri.007G122451.1 pacid=42765444 polypeptide=Potri.007G122451.1.p locus=Potri.007G122451 ID=Potri.007G122451.1.v4.1 annot-version=v4.1
MAVQKLFPVLFLQLALAFLLAGLTNAGGLQLGFYQGACPDAELIVHQTLYRYISRDPTLAAPLLRMHFHDCFIRGCEGSVLLSSTKNNQAEKDAIPNKTL
RGFNVIDAVKSALEKKCPGVVSCADILALVARDAVLMIGGPRWDVPTGRRDGRVSIANEALFNLPSPFANITVLKQQFAATGLSVKDLAVLSGGHTIGIG
HCTIISNRLYNFTGKGDTDPSLDPRYAAQLKNKCKPGNSNTVVEMDPGSFKSFDEDYYNIVAKRRGLFRSDAALLDDAETRGYVKFQSMTQGSTFAQDFA
ESMVKMGYIGVLTGEQGEIRKHCAVVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G15180 Peroxidase superfamily protein... Potri.007G122451 0 1
AT3G01190 Peroxidase superfamily protein... Potri.019G063201 1.41 0.9931
Potri.007G086400 2.00 0.9843
AT3G01190 Peroxidase superfamily protein... Potri.011G027300 7.00 0.9817
AT2G38940 PHT1;4, ATPT2 ARABIDOPSIS THALIANA PHOSPHATE... Potri.010G071700 7.41 0.9768 PtrPht1-2,PT2.9
AT3G02850 SKOR STELAR K+ outward rectifier, S... Potri.017G135400 8.30 0.9629 Pt-SKOR.4
AT1G27040 Major facilitator superfamily ... Potri.002G129500 8.48 0.9806
AT5G15180 Peroxidase superfamily protein... Potri.007G122401 8.66 0.9835
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Potri.006G272500 8.83 0.9827
AT3G02630 Plant stearoyl-acyl-carrier-pr... Potri.002G209602 10.39 0.9801
AT5G06720 ATPA2 peroxidase 2 (.1) Potri.004G144500 13.07 0.9373

Potri.007G122451 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.