Potri.007G122500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32360 66 / 8e-15 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G037500 159 / 1e-52 AT2G32360 67 / 2e-15 Ubiquitin-like superfamily protein (.1)
Potri.017G037400 92 / 2e-25 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015125 94 / 2e-26 AT2G32360 61 / 1e-12 Ubiquitin-like superfamily protein (.1)
Lus10027183 91 / 2e-25 AT2G32360 66 / 9e-15 Ubiquitin-like superfamily protein (.1)
Lus10039658 88 / 4e-24 AT2G32360 69 / 4e-16 Ubiquitin-like superfamily protein (.1)
Lus10031549 92 / 5e-24 AT3G05870 158 / 6e-50 anaphase-promoting complex/cyclosome 11 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Potri.007G122500.1 pacid=42766450 polypeptide=Potri.007G122500.1.p locus=Potri.007G122500 ID=Potri.007G122500.1.v4.1 annot-version=v4.1
ATGAGGGTGGTGGTGGAGATTTTGACAGGAACCCTTTTCTACATTCAAGTGGGCAATGATGCCACGGTTGCAGATCTTAAGAAAGAGATTGAGGCACAGC
AGAAACTACCTCAAGATCGTTTGATCCTGTTTCTCAGTAACAAACGAAGTCACCTGATAAATGAAGAAGGAGATGGGGCAGCTTTAGTTGATTGTGGGGT
TCAAGATGGATCTCATATCTACCTCTTCTTCGATCCGGTTGATAATCATGATGAATCTACTGATCATTTGGTTTTCACCTGGCCTCATTCTTTCTTGGAG
CAGGCATAG
AA sequence
>Potri.007G122500.1 pacid=42766450 polypeptide=Potri.007G122500.1.p locus=Potri.007G122500 ID=Potri.007G122500.1.v4.1 annot-version=v4.1
MRVVVEILTGTLFYIQVGNDATVADLKKEIEAQQKLPQDRLILFLSNKRSHLINEEGDGAALVDCGVQDGSHIYLFFDPVDNHDESTDHLVFTWPHSFLE
QA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G32360 Ubiquitin-like superfamily pro... Potri.007G122500 0 1

Potri.007G122500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.