Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	NAC149
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13180 86 / 7e-20 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT4G27410 87 / 8e-20 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT5G39820 86 / 4e-19 NAC ANAC094 NAC domain containing protein 94 (.1) AT2G33480 84 / 4e-19 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT1G52890 84 / 1e-18 NAC ANAC019 NAC domain containing protein 19 (.1) AT1G65910 84 / 2e-18 NAC ANAC028 NAC domain containing protein 28 (.1) AT3G15500 83 / 2e-18 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT5G17260 80 / 5e-17 NAC ANAC086 NAC domain containing protein 86 (.1) AT3G10490 78 / 5e-17 NAC ANAC051, ANAC052 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) AT5G61430 79 / 9e-17 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G031600 [exp] 402 / 1e-143 AT2G33480 90 / 3e-21 NAC domain containing protein 41 (.1.2) Potri.017G031000 [exp] 397 / 3e-141 AT2G33480 87 / 3e-20 NAC domain containing protein 41 (.1.2) Potri.017G031300 [exp] 397 / 3e-141 AT2G33480 87 / 3e-20 NAC domain containing protein 41 (.1.2) Potri.004G126901 [exp] 89 / 5e-20 AT5G39820 305 / 1e-101 NAC domain containing protein 94 (.1) Potri.017G082000 [exp] 87 / 2e-19 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.011G123300 [exp] 86 / 2e-19 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.001G061200 [exp] 84 / 3e-19 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G166500 [exp] 84 / 4e-19 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.001G404100 [exp] 83 / 2e-18 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002581 [exp] 88 / 2e-20 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10026617 [exp] 88 / 2e-20 AT1G69490 298 / 1e-101 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10030446 [exp] 87 / 6e-20 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10026496 [exp] 88 / 8e-20 AT1G61110 244 / 6e-79 NAC domain containing protein 25 (.1) Lus10001809 [exp] 84 / 4e-19 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10030478 [exp] 82 / 1e-17 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1) Lus10027357 [exp] 82 / 2e-17 AT3G04070 172 / 3e-50 NAC domain containing protein 47 (.1.2) Lus10015076 [exp] 81 / 3e-17 AT1G61110 247 / 5e-80 NAC domain containing protein 25 (.1) Lus10019926 [exp] 81 / 3e-17 AT1G61110 243 / 4e-78 NAC domain containing protein 25 (.1) Lus10007263 [exp] 81 / 3e-17 AT5G39820 300 / 3e-100 NAC domain containing protein 94 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.007G127700.1 pacid=42766541 polypeptide=Potri.007G127700.1.p locus=Potri.007G127700 ID=Potri.007G127700.1.v4.1 annot-version=v4.1 ATGGTGCCTCATGGGTTCAGGTTCAATCCCACTGATGAAGAGCTCATCCAGGTCCTAGACAGAAAAGCTTCTGGCCAAGAAATGCCACTCCATTTCATTC TTGAAATGAATGTTTATGAACGTGAACCACAGGATCTTGAATGGAATCAATCCACGGCTTTAAGCAATGGTGAGAGATTCTACTATTGTAAGAGGGAGAT AAATGATTCAAGGGAAGTGATCGGTCGAGGATGGTGGAAAGCTACAAGCCATGTCAAGAAAGTTTATGCAAATGATCATCAACTTCTTGTTGGGAACAAG AGGCCTTTGACATTCCATAGGTTCAAGGACAATGAAAGAAACCGCAATAATGCCATCAAGACTAATTGGATTATGCATGAATATAGCCTTGAATCAAGAA CCACGGAGTGGAGGCTTTGCAAGATTAAATATAAGGGAAAACCAAGTTTGCAAGAAGAGATAGAGAGTATTAAGAAACAACATTCATCGAGGAATGATTT CGAAGCCGGTAGCTCGACAAATGTTGGTGTGGAGCAGCATGAGGAGCAAACTTTGGTGCCTGCAGATTCAACAATGCCATTGGATCATTGTAACGGATAT CATCAGCAACCTCATGATCAATGGAACAATATGCAGCAGCTACCACCATCTCCATATCATCCTAATTATCTACCGGCATTGTGTACTGGTAGTGGCCACT ATTATGTTAACCAGCAAGAAGAGTTAGAGCCCGCTGTTCATGAGCAGCCATTTCCTAGTCTTTGGTCTTGGACGAACTAG
AA sequence Show only first row Show all	>Potri.007G127700.1 pacid=42766541 polypeptide=Potri.007G127700.1.p locus=Potri.007G127700 ID=Potri.007G127700.1.v4.1 annot-version=v4.1 MVPHGFRFNPTDEELIQVLDRKASGQEMPLHFILEMNVYEREPQDLEWNQSTALSNGERFYYCKREINDSREVIGRGWWKATSHVKKVYANDHQLLVGNK RPLTFHRFKDNERNRNNAIKTNWIMHEYSLESRTTEWRLCKIKYKGKPSLQEEIESIKKQHSSRNDFEAGSSTNVGVEQHEEQTLVPADSTMPLDHCNGY HQQPHDQWNNMQQLPPSPYHPNYLPALCTGSGHYYVNQQEELEPAVHEQPFPSLWSWTN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13180	NAC	VNDIP2, ANAC083...	VND-interacting 2, NAC domain ...		Potri.007G127700 [exp]	0	1	NAC149
AT4G22010		SKS4	SKU5 similar 4 (.1)		Potri.004G010100 [exp]	5.91	0.7644
AT4G35190		LOG5	LONELY GUY 5, Putative lysine ...		Potri.004G181800 [exp]	28.61	0.6618
AT5G06550			unknown protein		Potri.016G065400 [exp]	34.46	0.6164
AT1G07790		HTB1	Histone superfamily protein (....		Potri.008G029900 [exp]	113.59	0.5964
AT4G30770			Putative membrane lipoprotein ...		Potri.005G066500 [exp]	119.15	0.6008
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Potri.017G052600 [exp]	124.53	0.5874
					Potri.017G041400 [exp]	164.12	0.5879
AT1G57680			unknown protein		Potri.012G023500 [exp]	175.86	0.5694

Compare expression of checked genes

Potri.007G127700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.