Plant FIBer expression Database

Potri.007G128100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43310 129 / 2e-39 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G030200
[exp]
194 / 1e-65 AT2G43310 154 / 1e-49 Ribosomal L18p/L5e family protein (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G128100.2 pacid=42765231 polypeptide=Potri.007G128100.2.p locus=Potri.007G128100 ID=Potri.007G128100.2.v4.1 annot-version=v4.1
ATGTCGAGAAATCAGCAGCACCTTCTCCGGCTAGTCCTGTCTTGCCGAAAAATAACAGCTCAGGTATCAAACCCGACGACTTCCACAATAATCGCGATGG
CTTCTTCCTCCGAACAAGAATCATTCCTCTCTATCTACCGCAACACTTCCCTCTCTATCTTCTCTCGCCAATCCCGGGACTCAAAAACGGCGTCGCGTGT
TGGGGAGAAGTTAGGGTTTAGATTAAAGGAAATCGGGGTTAATAATATCTATATTGATTTAAACGAAGAGTTGTCAAGGCCGATTCATTATAGAAAGCGT
GTGTTGCCGTTGTTTGTTTCGGTGAAACGCGTCGGCATTGAAGTTGATGGAGCTGAGAAGCTAGGAGAGATCGGTCCTGTTTGA
AA sequence
>Potri.007G128100.2 pacid=42765231 polypeptide=Potri.007G128100.2.p locus=Potri.007G128100 ID=Potri.007G128100.2.v4.1 annot-version=v4.1
MSRNQQHLLRLVLSCRKITAQVSNPTTSTIIAMASSSEQESFLSIYRNTSLSIFSRQSRDSKTASRVGEKLGFRLKEIGVNNIYIDLNEELSRPIHYRKR
VLPLFVSVKRVGIEVDGAEKLGEIGPV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G43310 Ribosomal L18p/L5e family prot... Potri.007G128100
[exp]
0 1
AT1G78570 ATRHM1, RHM1, R... REPRESSOR OF LRX1 1, ARABIDOPS... Potri.001G383500
[exp]
2.23 0.8994
AT3G07480 2Fe-2S ferredoxin-like superfa... Potri.014G177100
[exp]
3.46 0.9249
AT3G24350 ATSYP32, SYP32 syntaxin of plants 32 (.1.2) Potri.006G157000
[exp]
13.56 0.9038
AT1G20430 unknown protein Potri.002G013601
[exp]
15.00 0.8893
AT2G16595 Translocon-associated protein ... Potri.004G168500
[exp]
16.12 0.9072
AT4G02500 ATXT2, XXT2 XYG XYLOSYLTRANSFERASE 2, ARAB... Potri.010G025300
[exp]
16.30 0.8375
AT2G39390 Ribosomal L29 family protein ... Potri.006G214200
[exp]
18.89 0.9059
AT3G52730 ubiquinol-cytochrome C reducta... Potri.004G188700
[exp]
20.34 0.8842
AT5G60980 Nuclear transport factor 2 (NT... Potri.015G058700
[exp]
20.49 0.8870
AT1G30890 Integral membrane HRF1 family ... Potri.017G028500
[exp]
21.07 0.8517

Potri.007G128100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.