Potri.007G129101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43280 142 / 8e-44 FAR1_related Far-red impaired responsive (FAR1) family protein (.1)
AT3G07500 89 / 7e-23 FAR1_related Far-red impaired responsive (FAR1) family protein (.1)
AT4G12850 77 / 3e-19 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
AT3G59470 72 / 2e-16 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2)
AT4G38180 69 / 2e-14 FAR1_related FRS5 FAR1-related sequence 5 (.1)
AT2G32250 61 / 8e-12 FAR1_related FRS2 FAR1-related sequence 2 (.1.2.3.4)
AT3G06250 57 / 2e-10 FAR1_related FRS7 FAR1-related sequence 7 (.1)
AT5G18960 55 / 8e-10 FAR1_related FRS12 FAR1-related sequence 12 (.1)
AT1G80010 52 / 1e-08 FAR1_related FRS8 FAR1-related sequence 8 (.1)
AT4G15090 51 / 2e-08 FAR1_related FAR1 FAR-RED IMPAIRED RESPONSE 1, FRS (FAR1 Related Sequences) transcription factor family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G029400 184 / 2e-60 AT2G43280 319 / 4e-112 Far-red impaired responsive (FAR1) family protein (.1)
Potri.014G176600 111 / 8e-32 AT4G12850 178 / 5e-57 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
Potri.002G239400 103 / 8e-29 AT4G12850 207 / 1e-68 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
Potri.014G176500 101 / 7e-28 AT3G07500 275 / 2e-94 Far-red impaired responsive (FAR1) family protein (.1)
Potri.007G129000 96 / 5e-26 AT2G43280 133 / 9e-40 Far-red impaired responsive (FAR1) family protein (.1)
Potri.008G076800 74 / 5e-17 AT3G59470 156 / 1e-46 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2)
Potri.011G145800 73 / 4e-16 AT4G38180 1003 / 0.0 FAR1-related sequence 5 (.1)
Potri.005G257600 73 / 6e-16 AT4G38180 891 / 0.0 FAR1-related sequence 5 (.1)
Potri.007G129500 71 / 6e-16 AT3G59470 260 / 9e-88 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026732 85 / 4e-22 AT3G07500 88 / 2e-22 Far-red impaired responsive (FAR1) family protein (.1)
Lus10026854 44 / 9e-06 AT3G59470 121 / 1e-32 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2)
Lus10020226 41 / 7e-05 AT3G59470 120 / 7e-33 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0274 WRKY-GCM1 PF03101 FAR1 FAR1 DNA-binding domain
Representative CDS sequence
>Potri.007G129101.1 pacid=42766725 polypeptide=Potri.007G129101.1.p locus=Potri.007G129101 ID=Potri.007G129101.1.v4.1 annot-version=v4.1
ATGGATATAGATGAGGGAATTGAAATAGTAGAGAGCTCTGTTGGAAAAGAAATGGTTGAAAACGCTGGAAAAGATACGGTTGTAGAACCACATAAGGGCA
TGGAGTTTGAATCAGAAGATGCCGCGAAGGTATTCTATTATGAATATGCTCGGCAGATAGGGTTTGTAATGCGAGTAATGTCTTGTCGTCGTTCTGAAAG
AGATGGGAGGATTCTTGCCAGGCGACTTGGGTGTAATAAGGAGGGTTATTGCGTGAGCATTCGAGGGAAATTTGGAAATGTTCGAAAGCCACGCATGAGT
GCTAGAGAAGGTTGCAAGGCAATATGGTTCATGTTAAGTTTGATAAGTCTGGAAAATGGGTGGTAA
AA sequence
>Potri.007G129101.1 pacid=42766725 polypeptide=Potri.007G129101.1.p locus=Potri.007G129101 ID=Potri.007G129101.1.v4.1 annot-version=v4.1
MDIDEGIEIVESSVGKEMVENAGKDTVVEPHKGMEFESEDAAKVFYYEYARQIGFVMRVMSCRRSERDGRILARRLGCNKEGYCVSIRGKFGNVRKPRMS
AREGCKAIWFMLSLISLENGW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G43280 FAR1_related Far-red impaired responsive (F... Potri.007G129101 0 1
Potri.014G151351 18.89 0.5373
AT3G09510 Ribonuclease H-like superfamil... Potri.004G015067 24.65 0.5787
AT5G51330 DYAD, SWI1 SWITCH1 (.1) Potri.003G106800 28.72 0.5715 Pt-SWI1.2
Potri.014G104750 31.65 0.5409
AT5G14010 C2H2ZnF KNUCKLES, KNU KNUCKLES, C2H2 and C2HC zinc f... Potri.001G324600 35.49 0.5198
Potri.006G122650 51.02 0.4947
AT2G17570 Undecaprenyl pyrophosphate syn... Potri.002G039400 56.17 0.4997
Potri.010G112101 63.99 0.4394
Potri.001G339700 82.23 0.4367
AT4G22080 RHS14 root hair specific 14 (.1) Potri.011G008000 217.02 0.3632

Potri.007G129101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.