Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22720 239 / 5e-80 Actin-like ATPase superfamily protein (.1.2) AT2G45270 48 / 4e-07 GCP1 glycoprotease 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G029200 [exp] 258 / 5e-87 AT4G22720 652 / 0.0 Actin-like ATPase superfamily protein (.1.2) Potri.014G067800 [exp] 47 / 6e-07 AT2G45270 655 / 0.0 glycoprotease 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013054 [exp] 232 / 6e-79 AT4G22720 352 / 6e-123 Actin-like ATPase superfamily protein (.1.2) Lus10029108 [exp] 231 / 1e-78 AT4G22720 352 / 3e-123 Actin-like ATPase superfamily protein (.1.2) Lus10000791 [exp] 50 / 9e-08 AT2G45270 664 / 0.0 glycoprotease 1 (.1) Lus10030285 [exp] 44 / 8e-06 AT2G45270 550 / 0.0 glycoprotease 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0108 [poplar] [flax] Actin_ATPase PF00814 [poplar] [flax] TsaD tRNA N6-adenosine threonylcarbamoyltransferase
Representative CDS sequence Show only first row Show all	>Potri.007G129400.1 pacid=42765381 polypeptide=Potri.007G129400.1.p locus=Potri.007G129400 ID=Potri.007G129400.1.v4.1 annot-version=v4.1 ATGAAGAGAATGACAGCACTAGGATTTGAAGGTTCCGCAAACAAGATAGGAGTTGGGGTTGATACATTAGATGGTACAATTTTGTCAAATCCAAGACATA CTTATATAACCCCAGCTGGTCAAGGTTTTTTGCCAAGAGAAACAGCCCAACATCATTTGCAACATGTTTTACCACTTATAAAATCTGCTTTAGAGACTGC GGGAATTACCTCAGATGAAATTGACTGTCTTTGTTACACTAAAGGTCCTGGTATGGGAGCACCTTTACAAGTGTCTGCTGTTGTTGTTAGAGTTCTTTCA CAGCTGTGGAAGAAACCAATTGTTGCTGTTAATCATTGTGTTGCACATATTGAGATGGGTAGGATTGTTACTGGGGCGGATGATCCTGTTATTAAACCTT TGATGGGTTTCGATAGCTGA
AA sequence Show only first row Show all	>Potri.007G129400.1 pacid=42765381 polypeptide=Potri.007G129400.1.p locus=Potri.007G129400 ID=Potri.007G129400.1.v4.1 annot-version=v4.1 MKRMTALGFEGSANKIGVGVDTLDGTILSNPRHTYITPAGQGFLPRETAQHHLQHVLPLIKSALETAGITSDEIDCLCYTKGPGMGAPLQVSAVVVRVLS QLWKKPIVAVNHCVAHIEMGRIVTGADDPVIKPLMGFDS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G22720			Actin-like ATPase superfamily ...		Potri.007G129400 [exp]	0	1
AT2G36835			unknown protein		Potri.006G122200 [exp]	3.16	0.6563
AT5G27930			Protein phosphatase 2C family ...		Potri.013G012200 [exp]	4.24	0.6835
ATCG00700		ATCG00700.1, PS...	photosystem II reaction center...		Potri.011G113700 [exp]	5.65	0.7005
AT1G52340		SIS4, SDR1, ISI...	SHORT-CHAIN DEHYDROGENASE REDU...		Potri.016G073800 [exp]	7.34	0.6049	Pt-CTS2.12
AT1G43850		SEU	SEUSS transcriptional co-regul...		Potri.013G089900 [exp]	8.83	0.6557
AT3G16230			Predicted eukaryotic LigT (.1....		Potri.001G186600 [exp]	13.07	0.6767
AT3G03420			Ku70-binding family protein (....		Potri.017G120800 [exp]	25.61	0.6252
AT5G54880			DTW domain-containing protein ...		Potri.001G423900 [exp]	30.80	0.6333
AT1G15390		PDF1A, ATDEF1	peptide deformylase 1A (.1)		Potri.001G171800 [exp]	31.52	0.6515	PDF1.2
AT1G15100		RHA2A	RING-H2 finger A2A (.1)		Potri.007G086300 [exp]	32.61	0.6178

Compare expression of checked genes

Potri.007G129400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.