Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrGrx2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28480 141 / 7e-44 roxy19, GRX480 Thioredoxin superfamily protein (.1) AT1G03850 113 / 9e-33 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2) AT5G14070 96 / 9e-26 ROXY2 Thioredoxin superfamily protein (.1) AT4G15700 94 / 1e-25 Thioredoxin superfamily protein (.1) AT4G15690 93 / 2e-25 Thioredoxin superfamily protein (.1) AT5G18600 88 / 2e-23 Thioredoxin superfamily protein (.1) AT4G15670 87 / 4e-23 Thioredoxin superfamily protein (.1) AT4G15680 87 / 6e-23 Thioredoxin superfamily protein (.1) AT4G15660 86 / 1e-22 Thioredoxin superfamily protein (.1) AT4G33040 83 / 1e-20 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G017300 [exp] 270 / 3e-94 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1) Potri.011G058800 [exp] 145 / 2e-45 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1) Potri.004G049800 [exp] 143 / 2e-44 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 100 / 7e-28 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 98 / 5e-27 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 98 / 8e-27 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 83 / 3e-21 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.006G226900 [exp] 81 / 5e-20 AT4G33040 184 / 8e-61 Thioredoxin superfamily protein (.1) Potri.002G209300 [exp] 79 / 8e-20 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018631 [exp] 158 / 2e-50 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1) Lus10039867 [exp] 156 / 7e-50 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1) Lus10013962 [exp] 137 / 3e-42 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 105 / 1e-29 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1) Lus10017693 [exp] 100 / 1e-28 AT1G28480 100 / 4e-29 Thioredoxin superfamily protein (.1) Lus10038514 [exp] 100 / 1e-27 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1) Lus10033649 [exp] 98 / 2e-27 AT1G28480 100 / 5e-29 Thioredoxin superfamily protein (.1) Lus10023295 [exp] 97 / 2e-26 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 97 / 4e-26 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 95 / 1e-25 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.007G134800.1 pacid=42766316 polypeptide=Potri.007G134800.1.p locus=Potri.007G134800 ID=Potri.007G134800.1.v4.1 annot-version=v4.1 ATGCAGCAGGCAATACCTTACAAGTCATGGCCACCTTTATACACCAACAACAAGCCTCTAATAAGCCCTTTTCAACTTATTGCCCGCCACAACAATGGTG GGGTGGTTGCAACTCAAGAAGTGCTAAAAGGGTCAGGAAATATGAGCAAGATGGTGCAAGAAAATGCAATCATAGTGTTTGCTAGACGTGGATGCTGCAT GAGCCTTGTAGCGAAACGTTTGCTTCTAGGGCTTGGTGTGAATCCAGCAGTTTATGAGATTGATGAGGCTGATGAGATTAGTGTCTTGGAAGAATTGGAA ATGATCTGCAATGATGGTGGAAAGGGGAGTAAGAAGAAAGTACAGTTTCCTGCTCTTTTTATTGGTGGAAAGTTGTTTGGTGGATTGGATAAACTTATGG CTGCTCATATTTCTGGAGAATTGGTTCCTATTTTGAAAGAAGCTGGAGCCTTATGGCTTTGA
AA sequence Show only first row Show all	>Potri.007G134800.1 pacid=42766316 polypeptide=Potri.007G134800.1.p locus=Potri.007G134800 ID=Potri.007G134800.1.v4.1 annot-version=v4.1 MQQAIPYKSWPPLYTNNKPLISPFQLIARHNNGGVVATQEVLKGSGNMSKMVQENAIIVFARRGCCMSLVAKRLLLGLGVNPAVYEIDEADEISVLEELE MICNDGGKGSKKKVQFPALFIGGKLFGGLDKLMAAHISGELVPILKEAGALWL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Potri.007G134800 [exp]	0	1	PtrGrx2
AT1G50600	GRAS	SCL5	scarecrow-like 5 (.1)		Potri.001G361700 [exp]	1.00	0.8730
AT1G10650			SBP (S-ribonuclease binding pr...		Potri.012G082200 [exp]	2.44	0.8316
AT2G30230			unknown protein		Potri.019G123900 [exp]	3.74	0.7931
AT5G23130			Peptidoglycan-binding LysM dom...		Potri.007G071500 [exp]	8.12	0.7693
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Potri.003G066300 [exp]	22.53	0.8091
AT2G23810		TET8	tetraspanin8 (.1)		Potri.018G099800 [exp]	23.36	0.7512
AT5G04550			Protein of unknown function (D...		Potri.010G233700 [exp]	24.33	0.7523
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Potri.007G128600 [exp]	27.16	0.7210
AT2G35380			Peroxidase superfamily protein...		Potri.001G145800 [exp]	31.08	0.7496
AT2G26110			Protein of unknown function (D...		Potri.001G008160 [exp]	34.49	0.7796

Compare expression of checked genes

Potri.007G134800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.