Plant FIBer expression Database

Potri.007G135201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G135201.1 pacid=42766333 polypeptide=Potri.007G135201.1.p locus=Potri.007G135201 ID=Potri.007G135201.1.v4.1 annot-version=v4.1
ATGAAAATTCATACACAGATAGCAAATATGTATAAAACTAGCAGCCACACACAGCTAGACTACTGTTTCTACAACCAAAGTATTATGATTTCTTCTCTTC
TCTTCTTTTGTAGATTTTCTACGACGTCTAGGGTTTTTTCCTCAAGCCTTTTTCGTTCAACACCTTTCTTGATTTTCCTTTCAATCCTAATTAATCTTGT
TTCAGGCCACGTCATTAACCCGTTCTTCAACTCTTTTCCTTATTCCATGTCTCTTCATATTTTCGTTTCCATTCCAAGATTCCTGCTCTGCAGAATCCAG
CATTCCAAGTGA
AA sequence
>Potri.007G135201.1 pacid=42766333 polypeptide=Potri.007G135201.1.p locus=Potri.007G135201 ID=Potri.007G135201.1.v4.1 annot-version=v4.1
MKIHTQIANMYKTSSHTQLDYCFYNQSIMISSLLFFCRFSTTSRVFSSSLFRSTPFLIFLSILINLVSGHVINPFFNSFPYSMSLHIFVSIPRFLLCRIQ
HSK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G135201
[exp]
0 1
AT2G20470 AGC (cAMP-dependent, cGMP-depe... Potri.005G226700
[exp]
7.14 0.8661
AT1G27920 MAP65-8 microtubule-associated protein... Potri.001G055100
[exp]
13.41 0.8628
AT2G30933 Carbohydrate-binding X8 domain... Potri.002G059600
[exp]
16.88 0.8320
AT2G31930 unknown protein Potri.009G024700
[exp]
17.40 0.8598
AT4G27730 ATOPT6 ARABIDOPSIS THALIANA OLIGOPEPT... Potri.012G019500
[exp]
17.77 0.8505
AT3G15810 Protein of unknown function (D... Potri.006G067000
[exp]
19.44 0.8487
AT1G80210 BRCC36A, AtBRCC... BRCA1/BRCA2-containing complex... Potri.001G172800
[exp]
20.14 0.8468
AT3G63470 SCPL40 serine carboxypeptidase-like 4... Potri.001G261100
[exp]
20.66 0.8053 A.2
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Potri.019G120900
[exp]
21.79 0.8496 Pt-FLA14.3
AT5G35960 Protein kinase family protein ... Potri.014G136300
[exp]
27.27 0.8449

Potri.007G135201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.