Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20585 66 / 1e-15 NFD6 nuclear fusion defective 6 (.1.2.3) AT1G28395 60 / 4e-13 unknown protein AT2G33847 50 / 2e-09 unknown protein AT1G55205 36 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G014500 [exp] 111 / 2e-33 AT2G20585 72 / 5e-18 nuclear fusion defective 6 (.1.2.3) Potri.004G048100 [exp] 76 / 3e-19 AT1G28395 91 / 1e-25 unknown protein Potri.011G057300 [exp] 64 / 6e-15 AT1G28395 103 / 2e-30 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002171 [exp] 88 / 4e-24 AT2G20585 81 / 2e-21 nuclear fusion defective 6 (.1.2.3) Lus10039888 [exp] 85 / 9e-23 AT2G20585 77 / 2e-19 nuclear fusion defective 6 (.1.2.3) Lus10013008 [exp] 51 / 2e-09 AT1G70350 59 / 3e-12 unknown protein Lus10029157 [exp] 50 / 6e-09 AT1G70350 59 / 2e-12 unknown protein Lus10024700 [exp] 40 / 4e-05 AT1G55205 80 / 4e-20 unknown protein Lus10023655 [exp] 36 / 0.0007 AT1G55205 83 / 3e-22 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G137500.7 pacid=42765036 polypeptide=Potri.007G137500.7.p locus=Potri.007G137500 ID=Potri.007G137500.7.v4.1 annot-version=v4.1 ATGGCCTCATTTACAGCCGCCAGATCCATTTTCCGGTCATCCGCCGCCCGTAACGCGGCGGCCCGCCTTGCTTCTCAATCCAAATCCAAACCTAAAGCCC CCCCCTTTAGCCTCAACTCCACTGCCAACAAACCCGTTCTCAGGAGGAGTCCAGTGGAAATGAGCTTTGCTGTTGAATCAATGATGCCTTACCATACAGT GACTGCTTCTGCTTTGATGACTTCAATGCTCTCCATTTCTCGCTGCGGTTATGGCTGGCTTCCTGAAGGACGAGTCAAGACTAGATGA
AA sequence Show only first row Show all	>Potri.007G137500.7 pacid=42765036 polypeptide=Potri.007G137500.7.p locus=Potri.007G137500 ID=Potri.007G137500.7.v4.1 annot-version=v4.1 MASFTAARSIFRSSAARNAAARLASQSKSKPKAPPFSLNSTANKPVLRRSPVEMSFAVESMMPYHTVTASALMTSMLSISRCGYGWLPEGRVKTR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20585		NFD6	nuclear fusion defective 6 (.1...		Potri.007G137500 [exp]	0	1
AT2G19080			metaxin-related (.1)		Potri.006G077100 [exp]	4.47	0.8905
AT2G31725			Eukaryotic protein of unknown ...		Potri.013G127400 [exp]	6.16	0.9057
AT1G57720			Translation elongation factor ...		Potri.003G004700 [exp]	6.92	0.9061
AT1G16740			Ribosomal protein L20 (.1)		Potri.017G119300 [exp]	6.92	0.8994
AT5G14800		EMB2772, AT-P5C...	EMBRYO DEFECTIVE 2772, pyrroli...		Potri.006G042600 [exp]	9.79	0.8829
AT3G55605			Mitochondrial glycoprotein fam...		Potri.010G198500 [exp]	14.07	0.8624
AT3G09630			Ribosomal protein L4/L1 family...		Potri.006G132551 [exp]	16.52	0.8709
AT4G31985			Ribosomal protein L39 family p...		Potri.006G260837 [exp]	16.58	0.8740
AT2G34050			unknown protein		Potri.004G052200 [exp]	17.43	0.8285
AT3G20000		TOM40	translocase of the outer mitoc...		Potri.007G000200 [exp]	22.71	0.8715	Pt-TOM40.1

Compare expression of checked genes

Potri.007G137500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.