Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53970 225 / 9e-73 TAT7 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) AT5G36160 224 / 3e-72 Tyrosine transaminase family protein (.1) AT4G28410 206 / 3e-65 Tyrosine transaminase family protein (.1) AT2G20610 206 / 5e-65 RTY1, RTY, HLS3, ALF1, SUR1 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2) AT4G28420 201 / 7e-63 Tyrosine transaminase family protein (.1.2) AT4G23600 187 / 5e-59 JR2, CORI3, TAT1 JASMONIC ACID RESPONSIVE 2, CORONATINE INDUCED 1, Tyrosine transaminase family protein (.1.2.3) AT2G24850 180 / 5e-55 TAT3 tyrosine aminotransferase 3 (.1) AT4G23590 178 / 1e-54 Tyrosine transaminase family protein (.1) AT1G80360 42 / 0.0001 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G137950 [exp] 369 / 3e-129 AT5G53970 504 / 2e-178 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.007G137900 [exp] 283 / 1e-95 AT5G53970 457 / 4e-160 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.017G014200 [exp] 277 / 5e-93 AT5G36160 540 / 0.0 Tyrosine transaminase family protein (.1) Potri.017G013800 [exp] 266 / 1e-88 AT5G36160 520 / 0.0 Tyrosine transaminase family protein (.1) Potri.017G013900 [exp] 265 / 2e-88 AT5G53970 521 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.017G014000 [exp] 263 / 2e-87 AT5G53970 520 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.017G014100 [exp] 258 / 1e-85 AT5G53970 528 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.007G138052 [exp] 49 / 1e-08 AT5G36160 44 / 5e-07 Tyrosine transaminase family protein (.1) Potri.014G124100 [exp] 45 / 1e-05 AT1G77670 289 / 6e-94 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033659 [exp] 251 / 1e-82 AT5G36160 481 / 3e-169 Tyrosine transaminase family protein (.1) Lus10017703 [exp] 250 / 3e-82 AT2G20610 486 / 1e-170 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2) Lus10018626 [exp] 247 / 3e-81 AT2G20610 517 / 0.0 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2) Lus10017934 [exp] 246 / 4e-81 AT5G53970 619 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10039861 [exp] 246 / 1e-80 AT2G20610 509 / 1e-179 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2) Lus10017705 [exp] 243 / 2e-79 AT5G53970 507 / 1e-179 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10033661 [exp] 239 / 6e-78 AT5G36160 499 / 1e-176 Tyrosine transaminase family protein (.1) Lus10017704 [exp] 235 / 1e-76 AT5G53970 508 / 4e-180 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10013676 [exp] 234 / 3e-73 AT5G53970 617 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10033660 [exp] 194 / 9e-62 AT5G53970 408 / 3e-142 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0061 [poplar] [flax] PLP_aminotran PF00155 [poplar] [flax] Aminotran_1_2 Aminotransferase class I and II
Representative CDS sequence Show only first row Show all	>Potri.007G138002.1 pacid=42766465 polypeptide=Potri.007G138002.1.p locus=Potri.007G138002 ID=Potri.007G138002.1.v4.1 annot-version=v4.1 ATGGGTGTTTTTGGATCAACTGTGCCTGTTATTACCCTTGGATCCATATCGAAAAGATGGATGGTTCCCGGTTGGCGACTTGGATGGCTAGTAACAAGTG ATCCTACTGGTTTACTTCAAAAATGTGGGATCGCTGATTCCATTAAGAATGTTCTCAATCCTGCCCCTTTCTCGCCGACCTTTATTCAGGCCGCTGTTCC TGAAATCCTTGAGAAAACAACAGAGGAGTTCTTTTCAAAAACTATAAACATTCTTAGAGCAGCTTCAGCCTTCTGTTACGATAAACTGAAGGAGATACCG TGCATTACTTGCCCACAAAGGGCAGAAGGAGCCATGTTTGTTTTGGTGAAGCTTAACCTTTCACTTCTTGAAGACATCAAAGATGACATGGAGTTCTGTC TGAAGCTAGCTAAAGAGGAATCTCTCGTCATTTTACCAGGGGTGACTGTGGGACTAAAGAATTGGCTCCGCATAACATTTTCAGTTGAACAATCATCTCT TGAAGATGGTCTTGGAAGGTTAAGGTACTTCTGTGGGAGACATGCGAAGAAACCATAG
AA sequence Show only first row Show all	>Potri.007G138002.1 pacid=42766465 polypeptide=Potri.007G138002.1.p locus=Potri.007G138002 ID=Potri.007G138002.1.v4.1 annot-version=v4.1 MGVFGSTVPVITLGSISKRWMVPGWRLGWLVTSDPTGLLQKCGIADSIKNVLNPAPFSPTFIQAAVPEILEKTTEEFFSKTINILRAASAFCYDKLKEIP CITCPQRAEGAMFVLVKLNLSLLEDIKDDMEFCLKLAKEESLVILPGVTVGLKNWLRITFSVEQSSLEDGLGRLRYFCGRHAKKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53970		TAT7	tyrosine aminotransferase 7, T...		Potri.007G138002 [exp]	0	1
					Potri.019G014314 [exp]	5.29	0.8099
					Potri.019G014316 [exp]	7.93	0.7853
AT1G19715			Mannose-binding lectin superfa...		Potri.005G232400 [exp]	11.09	0.8030
AT1G62710		BETAVPE, BETA-V...	beta vacuolar processing enzym...		Potri.003G113300 [exp]	12.96	0.7772
AT1G09250	bHLH	bHLH149, AIF4	basic helix-loop-helix (bHLH) ...		Potri.013G007700 [exp]	16.52	0.7783
AT1G72830	CCAAT	NF-YA3, ATHAP2C...	"nuclear factor Y, subunit A3"...		Potri.006G145100 [exp]	20.19	0.7934	HAP2.6
					Potri.019G014368 [exp]	24.16	0.8032
AT5G64820			unknown protein		Potri.005G085000 [exp]	27.49	0.7904
AT5G60910	MADS	FUL, AGL8	FRUITFULL, AGAMOUS-like 8 (.1....		Potri.004G115400 [exp]	28.84	0.8025
AT1G72830	CCAAT	NF-YA3, ATHAP2C...	"nuclear factor Y, subunit A3"...		Potri.018G064700 [exp]	35.65	0.7552

Compare expression of checked genes

Potri.007G138002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.