Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36160 44 / 4e-07 Tyrosine transaminase family protein (.1) AT4G28420 44 / 5e-07 Tyrosine transaminase family protein (.1.2) AT5G53970 42 / 3e-06 TAT7 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) AT2G20610 41 / 7e-06 RTY1, RTY, HLS3, ALF1, SUR1 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G014200 [exp] 64 / 5e-14 AT5G36160 540 / 0.0 Tyrosine transaminase family protein (.1) Potri.017G013800 [exp] 52 / 7e-10 AT5G36160 520 / 0.0 Tyrosine transaminase family protein (.1) Potri.017G013900 [exp] 52 / 7e-10 AT5G53970 521 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.017G014000 [exp] 51 / 2e-09 AT5G53970 520 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.007G138002 [exp] 50 / 3e-09 AT5G53970 226 / 5e-73 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.007G137950 [exp] 50 / 4e-09 AT5G53970 504 / 2e-178 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.007G137900 [exp] 49 / 6e-09 AT5G53970 457 / 4e-160 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Potri.017G014100 [exp] 46 / 1e-07 AT5G53970 528 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039861 [exp] 55 / 6e-11 AT2G20610 509 / 1e-179 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2) Lus10018626 [exp] 53 / 4e-10 AT2G20610 517 / 0.0 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2) Lus10013676 [exp] 50 / 3e-09 AT5G53970 617 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10017934 [exp] 49 / 7e-09 AT5G53970 619 / 0.0 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10033661 [exp] 49 / 1e-08 AT5G36160 499 / 1e-176 Tyrosine transaminase family protein (.1) Lus10033660 [exp] 48 / 2e-08 AT5G53970 408 / 3e-142 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10017703 [exp] 47 / 5e-08 AT2G20610 486 / 1e-170 SUPERROOT 1, ROOTY 1, ROOTY, HOOKLESS 3, ABERRANT LATERAL ROOT FORMATION 1, Tyrosine transaminase family protein (.1.2) Lus10017704 [exp] 47 / 5e-08 AT5G53970 508 / 4e-180 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10017705 [exp] 46 / 1e-07 AT5G53970 507 / 1e-179 tyrosine aminotransferase 7, Tyrosine transaminase family protein (.1) Lus10033659 [exp] 45 / 2e-07 AT5G36160 481 / 3e-169 Tyrosine transaminase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G138052.1 pacid=42766043 polypeptide=Potri.007G138052.1.p locus=Potri.007G138052 ID=Potri.007G138052.1.v4.1 annot-version=v4.1 ATGGTTGTTCTTCCAGGCGTAGCTGCTGGACTGAAAAACTGGCCCCAGGTCACATTTTCCGTTGAGCCACAGTCTCTTGAACAAGGCCTCGACAGGATGA AAGTGTCATTAGCAGTGTCTCATGAGATATATAAAAATAACACAAAAATTTGTGATCTGTAA
AA sequence Show only first row Show all	>Potri.007G138052.1 pacid=42766043 polypeptide=Potri.007G138052.1.p locus=Potri.007G138052 ID=Potri.007G138052.1.v4.1 annot-version=v4.1 MVVLPGVAAGLKNWPQVTFSVEPQSLEQGLDRMKVSLAVSHEIYKNNTKICDL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36160			Tyrosine transaminase family p...		Potri.007G138052 [exp]	0	1
AT1G17860			Kunitz family trypsin and prot...		Potri.001G309900 [exp]	16.94	0.9373
AT4G03140			NAD(P)-binding Rossmann-fold s...		Potri.006G207100 [exp]	28.40	0.8711
AT5G19650	OFP	ATOFP8, OFP8	ovate family protein 8 (.1)		Potri.018G080100 [exp]	31.36	0.8971
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Potri.010G236800 [exp]	43.88	0.9219
AT2G31335			unknown protein		Potri.008G160650 [exp]	45.23	0.9214
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Potri.017G050400 [exp]	60.79	0.9204
AT1G73260		ATKTI1	ARABIDOPSIS THALIANA KUNITZ TR...		Potri.007G111600 [exp]	74.16	0.9173
AT3G04120		GAPC1, GAPC-1, ...	glyceraldehyde-3-phosphate deh...		Potri.008G179300 [exp]	92.30	0.9158	GAPDH.1
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Potri.006G058600 [exp]	103.58	0.9143	Pt-PGIP.4
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Potri.019G093800 [exp]	150.45	0.9083

Compare expression of checked genes

Potri.007G138052 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.