Potri.007G138400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G44265 76 / 8e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G28395 47 / 4e-07 ATA7 ARABIDOPSIS THALIANA ANTHER 7, ANTHER 7, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G51590 41 / 2e-05 LTP12 lipid transfer protein 12 (.1)
AT4G33355 39 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G138500 122 / 4e-37 AT5G44265 77 / 4e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.017G013200 100 / 3e-28 AT5G44265 106 / 1e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.002G012300 55 / 8e-11 AT5G44265 68 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012392 40 / 8e-05 AT4G33355 69 / 8e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10009911 39 / 0.0002 AT5G59320 72 / 4e-17 lipid transfer protein 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Potri.007G138400.1 pacid=42766834 polypeptide=Potri.007G138400.1.p locus=Potri.007G138400 ID=Potri.007G138400.1.v4.1 annot-version=v4.1
ATGGCTCGCATTGTTGGGTTTCTGATACTAGCAATTTCTACACAAGCTATGGCTAAGTTCGACGTGGACCCTCATCAGTGTCAGGTCATTTTCGATAACT
TCCCTTACTGTATGGATTTTCTTATAGGTTCAAACGATTGGCCTTCAAGCCAATGTTGTCAGCGGGTATATGACTTCAATGCATTAGCTGAGCACGGAAT
GGGGCCAAGAGCTATCTGTGAGTGCATTGAAATAATAATAAGGACGATCCCTATGAAGTTAAGGGCTGACCGTATCAGTGATCTTCCTGTCAGGTGCAAC
ACACATCTCAGTTTTCCCATTTCTGAGTATATGGACTGCAGCAGCATAAATTAA
AA sequence
>Potri.007G138400.1 pacid=42766834 polypeptide=Potri.007G138400.1.p locus=Potri.007G138400 ID=Potri.007G138400.1.v4.1 annot-version=v4.1
MARIVGFLILAISTQAMAKFDVDPHQCQVIFDNFPYCMDFLIGSNDWPSSQCCQRVYDFNALAEHGMGPRAICECIEIIIRTIPMKLRADRISDLPVRCN
THLSFPISEYMDCSSIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G44265 Bifunctional inhibitor/lipid-t... Potri.007G138400 0 1
AT5G10820 Major facilitator superfamily ... Potri.018G017400 1.00 0.9054
AT1G65480 FT FLOWERING LOCUS T, PEBP (phosp... Potri.008G077700 7.74 0.8248 Pt-PNFT3.4
AT2G26450 Plant invertase/pectin methyle... Potri.018G051200 10.48 0.8025
AT5G27470 seryl-tRNA synthetase / serine... Potri.007G070501 14.45 0.7318
AT3G05610 Plant invertase/pectin methyle... Potri.005G022900 16.58 0.6497 PEF1.2
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Potri.009G083500 17.32 0.6290
AT1G40390 DNAse I-like superfamily prote... Potri.003G066101 20.83 0.6176
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Potri.003G104600 24.45 0.6496
AT5G23290 PFD5, PDF5 prefoldin 5 (.1) Potri.005G090100 24.97 0.4806
Potri.002G025701 27.91 0.5619

Potri.007G138400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.