Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15270 140 / 3e-42 SBP SPL5 squamosa promoter binding protein-like 5 (.1) AT1G53160 139 / 8e-42 SBP SPL4 squamosa promoter binding protein-like 4 (.1.2) AT2G33810 125 / 6e-37 SBP SPL3 squamosa promoter binding protein-like 3 (.1) AT3G60030 122 / 2e-32 SBP SPL12 squamosa promoter-binding protein-like 12 (.1) AT2G42200 119 / 3e-32 SBP SPL9, AtSPL9 squamosa promoter binding protein-like 9 (.1) AT2G47070 120 / 1e-31 SBP SPL1 squamosa promoter binding protein-like 1 (.1) AT1G69170 117 / 5e-31 SBP SPL6 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1) AT1G02065 115 / 5e-31 SBP SPL8 squamosa promoter binding protein-like 8 (.1.2) AT1G20980 117 / 1e-30 SBP ATSPL14, SPL1R2, FBR6, SPL14 squamosa promoter binding protein-like 14 (.1) AT3G57920 111 / 2e-29 SBP SPL15, MSC1 squamosa promoter binding protein-like 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G116800 [exp] 180 / 7e-57 AT3G15270 159 / 5e-49 squamosa promoter binding protein-like 5 (.1) Potri.001G398200 [exp] 174 / 4e-55 AT1G53160 162 / 6e-51 squamosa promoter binding protein-like 4 (.1.2) Potri.004G046700 [exp] 132 / 3e-39 AT1G53160 135 / 4e-41 squamosa promoter binding protein-like 4 (.1.2) Potri.011G055900 [exp] 129 / 4e-38 AT2G33810 129 / 2e-39 squamosa promoter binding protein-like 3 (.1) Potri.016G048500 [exp] 120 / 2e-32 AT2G42200 217 / 3e-67 squamosa promoter binding protein-like 9 (.1) Potri.002G142400 [exp] 119 / 4e-32 AT1G27360 141 / 5e-38 squamosa promoter-like 11 (.1.2.3.4) Potri.008G098600 [exp] 121 / 6e-32 AT2G47070 833 / 0.0 squamosa promoter binding protein-like 1 (.1) Potri.014G057700 [exp] 117 / 8e-32 AT1G02065 247 / 3e-80 squamosa promoter binding protein-like 8 (.1.2) Potri.010G154000 [exp] 121 / 1e-31 AT2G47070 614 / 0.0 squamosa promoter binding protein-like 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039846 [exp] 174 / 6e-55 AT1G53160 129 / 8e-38 squamosa promoter binding protein-like 4 (.1.2) Lus10018610 [exp] 161 / 4e-50 AT3G15270 127 / 7e-37 squamosa promoter binding protein-like 5 (.1) Lus10005548 [exp] 132 / 8e-39 AT3G15270 133 / 1e-39 squamosa promoter binding protein-like 5 (.1) Lus10015421 [exp] 122 / 3e-35 AT2G33810 128 / 4e-39 squamosa promoter binding protein-like 3 (.1) Lus10013999 [exp] 121 / 3e-35 AT2G33810 128 / 6e-39 squamosa promoter binding protein-like 3 (.1) Lus10023818 [exp] 124 / 8e-34 AT2G42200 191 / 3e-57 squamosa promoter binding protein-like 9 (.1) Lus10016275 [exp] 121 / 2e-33 AT2G42200 179 / 1e-53 squamosa promoter binding protein-like 9 (.1) Lus10021034 [exp] 122 / 3e-33 AT2G42200 199 / 2e-60 squamosa promoter binding protein-like 9 (.1) Lus10028181 [exp] 120 / 1e-32 AT1G02065 224 / 4e-71 squamosa promoter binding protein-like 8 (.1.2) Lus10012020 [exp] 122 / 2e-32 AT2G42200 177 / 5e-51 squamosa promoter binding protein-like 9 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03110 [poplar] [flax] SBP SBP domain
Representative CDS sequence Show only first row Show all	>Potri.007G138800.1 pacid=42766026 polypeptide=Potri.007G138800.1.p locus=Potri.007G138800 ID=Potri.007G138800.1.v4.1 annot-version=v4.1 ATGGATGGTAAGGGGAAGCAAATTAGGATGGTGATGGGGAGGGAAGTAATGAAGAAGGATAGTGCTGATGACTCTTCAGATGATGAAGGGTATGAGCAAA ACCAGATGGGGTTTATGGAAGATGAATTTTTCGAGAGTAACAAGAAAAAGAAAGTGGTAGTTACTGCTGCTGCTGCTGCTGGTGGAGGAAGGAGGGTGTC AAGTGGTGGTGGAGGAGGGATGAGGTGTTGTCAAGTAGAGAAGTGTACAGCTAATCTGACTGATGCAAAGCAATATCATAGGAGGCATAAGGTTTGTGGA CATCATGCTAAGGCTCAGGTTGTGCTTGTAGCTGGAATTAGGCAGAGGTTTTGCCAGCAATGTAGCAGATTCCATGAACTATCAGAATTTGATGAAACCA AAAGAAGCTGTCGCAGGCGGTTGGCCGGACACAATGAGAGGCGAAGGAAGAATGTTGTTGAATCTCACGTGGAAGGCTCAAGCCGCAAAGTAAATGGAAC TCATGGCACTCAGTTGAAGGATATGGTATGTGGACAGGCTGATGAAAGGGGAAGAATTAAGATAACAATCCAAGAAAATGCGACTTACAAACATTTCCAG ATAAGCTAA
AA sequence Show only first row Show all	>Potri.007G138800.1 pacid=42766026 polypeptide=Potri.007G138800.1.p locus=Potri.007G138800 ID=Potri.007G138800.1.v4.1 annot-version=v4.1 MDGKGKQIRMVMGREVMKKDSADDSSDDEGYEQNQMGFMEDEFFESNKKKKVVVTAAAAAGGGRRVSSGGGGGMRCCQVEKCTANLTDAKQYHRRHKVCG HHAKAQVVLVAGIRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKNVVESHVEGSSRKVNGTHGTQLKDMVCGQADERGRIKITIQENATYKHFQ IS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15270	SBP	SPL5	squamosa promoter binding prot...		Potri.007G138800 [exp]	0	1
AT4G35100		SIMIP, PIP3A, P...	PLASMA MEMBRANE INTRINSIC PROT...		Potri.009G136600 [exp]	3.74	0.7764
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Potri.004G069700 [exp]	3.87	0.8124
AT5G50740			Heavy metal transport/detoxifi...		Potri.015G099500 [exp]	20.92	0.7978
					Potri.002G006800 [exp]	25.29	0.7525
AT5G06610			Protein of unknown function (D...		Potri.006G196800 [exp]	27.82	0.7950
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.016G142700 [exp]	35.98	0.7864
AT1G42430			unknown protein		Potri.002G011300 [exp]	36.94	0.7539
AT2G43330		ATINT1	inositol transporter 1 (.1)		Potri.017G032600 [exp]	41.68	0.7652
AT3G55580			Regulator of chromosome conden...		Potri.010G199100 [exp]	54.77	0.6347
AT4G04960			Concanavalin A-like lectin pro...		Potri.011G053200 [exp]	54.91	0.7318

Compare expression of checked genes

Potri.007G138800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.