Potri.007G140600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43840 375 / 3e-127 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2)
AT2G43820 366 / 5e-124 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
AT1G05680 315 / 4e-104 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT1G05675 309 / 1e-101 UDP-Glycosyltransferase superfamily protein (.1)
AT2G31790 291 / 1e-94 UDP-Glycosyltransferase superfamily protein (.1)
AT2G31750 290 / 4e-94 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT1G24100 283 / 1e-91 UGT74B1 UDP-glucosyl transferase 74B1 (.1)
AT4G15480 226 / 3e-69 UGT84A1 UDP-Glycosyltransferase superfamily protein (.1)
AT3G21560 213 / 5e-64 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1)
AT4G15490 212 / 6e-64 UGT84A3 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G117200 715 / 0 AT2G43840 461 / 1e-160 UDP-glycosyltransferase 74 F1 (.1.2)
Potri.007G140500 475 / 1e-166 AT2G43840 463 / 3e-161 UDP-glycosyltransferase 74 F1 (.1.2)
Potri.001G389200 365 / 2e-123 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.014G175000 361 / 6e-122 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2)
Potri.017G032300 352 / 3e-118 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1)
Potri.015G071900 344 / 3e-115 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1)
Potri.017G032500 332 / 2e-110 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.004G179300 325 / 1e-107 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032700 323 / 4e-107 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009412 414 / 2e-142 AT2G43820 474 / 1e-165 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10020556 411 / 2e-141 AT2G43820 472 / 1e-164 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10008742 393 / 4e-134 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10020559 387 / 7e-132 AT2G43820 436 / 3e-150 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10006352 366 / 1e-123 AT2G43820 414 / 6e-142 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10014148 350 / 2e-117 AT2G43840 407 / 2e-139 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10010712 340 / 2e-113 AT1G24100 462 / 1e-160 UDP-glucosyl transferase 74B1 (.1)
Lus10006353 338 / 9e-113 AT2G43820 398 / 1e-135 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10006721 334 / 2e-111 AT2G43820 392 / 9e-134 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10017825 318 / 6e-105 AT2G43840 392 / 2e-133 UDP-glycosyltransferase 74 F1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Potri.007G140600.2 pacid=42766202 polypeptide=Potri.007G140601.1.p locus=Potri.007G140600 ID=Potri.007G140600.2.v4.1 annot-version=v4.1
ATGGAAAACATGGTGAATACGAGCCATGTACTAGTAGTTCCACTGCCAGGCGCAGGCCACGTAAATCCCATGCTGCAGTTCTCTAGGCGTTTGGTCTCCA
AAGGGCTCAAAGTCACCTTCATAATCACCAAATTCATATCCAAGTCCAGGCAACTTGGCTCATCAATTGGTTCCATTCAACTCGATACCATATCAGATGG
CTATGACGATGGATTTAATCAAGCTGGTAGCAGGGAACCCTATCTTTCAAGCCTACATGATGTTGGTCCAAAAACCCTATCAGAACTCATCAAGAGATAC
CAAACCTCTTCAAGCCCTATCCATGCTGTAATATACGAGCCTTTCTTGGCTTGGGCTCTGGATGTGGCAAAGGATTTTGGGTTATTTGCAGCTGCTTTTT
TTACATGCTTATGCCAGTTACTTCAACCCGTGTTGATCGAGGGATTACCACTACTGCTTGAGCTTCAAGACTTGCCAACATTTGTTGTTCTGCCAGATTC
ATATCCTGCTAATGTTAAGATGACCATGAGTCAGTTTGCTAATCTGGACAAGGCTGATTGGATCCTCATCAACACTTTCTACAAGCTGGAGTGTGAGGTA
GTGGATACAATGTCAAAAGTTTGTCCATTATTGACAATTGGACCAACAATCCCATCAATATACTTGGACAAGAGTATTGAAGATGAGGATGACTACGGTA
TTAGTCTCTGTGAAATAGACGCATCTCTTTCTATAAATTGGCTCAGGACTAAGCCCACTACATCAGTTGTATATATGTCCTTTGGTAGCTGTGCTACTCT
AAGCAGCAAGCAAATGGAGGAAATTGCGTGGGGCTTAAAGAGGAGCAATTTTCACTTTTGGTTTGTTGAAGAAGTGGAGAATAAGGGATTGGCAGTGAAT
TGGAGTCCCCAAGTGAAAGTGCTAGCAAATGAGGCTGTGGGATGTTTTTTCACACATTGCAGTTGGAACTCAACAATCGAGGTATTGAGCTTGGGTGTGC
CAATGGTGACAATGCCAGGATGGAGTGATCAACAAACAAATTCTAAAATCGTTGAAGATGCTTGGAAGGTGGGAGTCAGAGCTAAGGTTGATGAGCATGG
AATTGTGAAAAGAGAAGAGATTGCCATTTGCATAAAAGAAGTGATGGAGGGAGATAGAGGCAAAGAAATGAAAATGAATTCCAAGAAATGGAAAGATGAT
GGGGACATCGAACCGGAAACATTGTGA
AA sequence
>Potri.007G140600.2 pacid=42766202 polypeptide=Potri.007G140601.1.p locus=Potri.007G140600 ID=Potri.007G140600.2.v4.1 annot-version=v4.1
MENMVNTSHVLVVPLPGAGHVNPMLQFSRRLVSKGLKVTFIITKFISKSRQLGSSIGSIQLDTISDGYDDGFNQAGSREPYLSSLHDVGPKTLSELIKRY
QTSSSPIHAVIYEPFLAWALDVAKDFGLFAAAFFTCLCQLLQPVLIEGLPLLLELQDLPTFVVLPDSYPANVKMTMSQFANLDKADWILINTFYKLECEV
VDTMSKVCPLLTIGPTIPSIYLDKSIEDEDDYGISLCEIDASLSINWLRTKPTTSVVYMSFGSCATLSSKQMEEIAWGLKRSNFHFWFVEEVENKGLAVN
WSPQVKVLANEAVGCFFTHCSWNSTIEVLSLGVPMVTMPGWSDQQTNSKIVEDAWKVGVRAKVDEHGIVKREEIAICIKEVMEGDRGKEMKMNSKKWKDD
GDIEPETL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G43840 UGT74F1 UDP-glycosyltransferase 74 F1 ... Potri.007G140600 0 1
AT2G24520 AHA5 H\(+\)-ATPase 5, H\(+\)-ATPase... Potri.006G275000 1.73 0.9069 Pt-VHA1.2
AT5G20070 ATNUDX19, ATNUD... ARABIDOPSIS THALIANA NUDIX HYD... Potri.018G070400 2.00 0.9231
AT2G19130 S-locus lectin protein kinase ... Potri.013G149500 5.47 0.9133
AT1G07230 NPC1 non-specific phospholipase C1 ... Potri.009G045100 11.83 0.8982
AT5G64230 unknown protein Potri.017G053200 12.24 0.8959
AT1G06570 HPPD, HPD, PDS1 4-hydroxyphenylpyruvate dioxyg... Potri.002G057400 16.15 0.8916 PDS1.2
AT5G58660 2-oxoglutarate (2OG) and Fe(II... Potri.001G278200 18.46 0.8912
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Potri.001G258100 19.18 0.9061
AT5G13750 ZIFL1 zinc induced facilitator-like ... Potri.008G010600 19.74 0.8724
AT3G16520 UGT88A1 UDP-glucosyl transferase 88A1 ... Potri.017G150000 19.89 0.8663

Potri.007G140600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.