Potri.007G140700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05680 358 / 2e-120 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1)
AT1G05675 353 / 7e-119 UDP-Glycosyltransferase superfamily protein (.1)
AT2G43820 319 / 3e-105 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
AT2G31750 311 / 2e-102 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT2G31790 306 / 4e-100 UDP-Glycosyltransferase superfamily protein (.1)
AT2G43840 303 / 4e-99 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2)
AT1G24100 278 / 2e-89 UGT74B1 UDP-glucosyl transferase 74B1 (.1)
AT4G15490 209 / 1e-62 UGT84A3 UDP-Glycosyltransferase superfamily protein (.1)
AT3G21560 206 / 2e-61 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1)
AT4G15480 204 / 1e-60 UGT84A1 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G389200 508 / 4e-179 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.007G140300 423 / 4e-146 AT1G05680 457 / 4e-159 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.004G179300 402 / 8e-138 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032300 396 / 2e-135 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G032733 385 / 7e-131 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032700 385 / 7e-131 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.017G032500 383 / 3e-130 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1)
Potri.014G175000 348 / 2e-116 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2)
Potri.015G071900 328 / 5e-109 AT1G24100 427 / 5e-147 UDP-glucosyl transferase 74B1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008742 362 / 8e-122 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10010712 315 / 1e-103 AT1G24100 462 / 1e-160 UDP-glucosyl transferase 74B1 (.1)
Lus10006353 315 / 2e-103 AT2G43820 398 / 1e-135 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10009412 309 / 3e-101 AT2G43820 474 / 1e-165 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10020556 305 / 2e-99 AT2G43820 472 / 1e-164 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10014148 303 / 6e-99 AT2G43840 407 / 2e-139 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10024117 295 / 2e-95 AT1G05675 385 / 4e-130 UDP-Glycosyltransferase superfamily protein (.1)
Lus10006352 294 / 2e-95 AT2G43820 414 / 6e-142 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
Lus10017825 290 / 7e-94 AT2G43840 392 / 2e-133 UDP-glycosyltransferase 74 F1 (.1.2)
Lus10024118 278 / 4e-89 AT1G05675 375 / 2e-126 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence
>Potri.007G140700.1 pacid=42764894 polypeptide=Potri.007G140701.1.p locus=Potri.007G140700 ID=Potri.007G140700.1.v4.1 annot-version=v4.1
ATGGTCAAGGAAAAAAGAGTTAGGGAGAGTCATGTCCTAGTACTCCCTTTGCCTCTGCAGGGTCATATAAACCCAATGCTGCAATTTTCCAAACGTCTAG
CCTCAAAAGGCCTCAAGGTCACGCTCATCATCACCCCTTCTATTGCCAAGTCTATGCAAGGCCAAGATAGTTCCATCAATTTGGAACCAATCTTTGATGG
ATCCAAGGAAGGTGAAATGACAATAAACATTGATAAGTATTTCGAGCGTTACAAGCTCACAATGCCTCACAGCTTATCCAACCTCATTGATAGATATAAT
GGTAGTGAATATCCCGTTAAGTTTCTCATATATGATTCTGTCCTACCATGGGCATTAGATATGGCTCGAAATAAAGGCATAGAAGGTGGTCCATTTTTCA
CTCAATCTTGTGCAGTTACTGCTGTTCTTTATCATGCCGCTCAGGGGGCATTTCAAGTTCCAGTAGAAGAGTATGATCAGGCAGCCGTGTCCTTGCCTTC
GTTGGAAAATTTGGAGTTCAATGATCTACCATCATTTGTTAGTGATGCAGGTTCATATCCAGCTATACGAGAACTCCTCCTTGGTCACTTGAAGTTGAAG
TGTGAACTCCTATTCCTTCATAATATAGTAGTGAACTGGATGAGAATCAATAAATGGCCAATCAAACCAATAGGACCAATGATTCCATCAATGTTCTTGG
ACAAGCGGTTGGGATATGACAAAGATTATGGCTTAAACCTTTTCAAGCCCAATTCAGATGCTTGCATGAAGTGGATGGACTTGAAGGAACCAGGGTCAGT
TGTGTATGTCTCATTTGGAAGCCTGGCTGCCGTCGGAGAAGAGCAAATGGCAGAGCTGGCCTGGGTTTTGGCTCACAAATTAGTTGGATGCTTCATGACT
CATTGTGGGTGGAACTCAACACTCGAGGCATTGAGCTTAGGAGTGCCAATGGTGGCAATGCCACAGTGGACTGATCAACCAACCAATGCTAAGTATATCA
CTGATGTTGGGCATGTAAGAGTTAGAGTAAATGTAAATGAAAAGGGGATTGTCACCAAAGAAGAGGTAGAAAGGTACATAAGGGAAGTCATGGAAAGTGA
AAGAAGCAATGCGATAAGAGGGAATTTTGATAAATGGAAGAAATTAGCCCAAACGGCAGTAGATATAGGTGGGAGCTCTGATAAGAATATTGAGGAGTTT
GTAACTGAGGTTGCTTGCACGTCCCAAAGGTATCGTAAAGTGAGGCACTTGCTGTCTTGA
AA sequence
>Potri.007G140700.1 pacid=42764894 polypeptide=Potri.007G140701.1.p locus=Potri.007G140700 ID=Potri.007G140700.1.v4.1 annot-version=v4.1
MVKEKRVRESHVLVLPLPLQGHINPMLQFSKRLASKGLKVTLIITPSIAKSMQGQDSSINLEPIFDGSKEGEMTINIDKYFERYKLTMPHSLSNLIDRYN
GSEYPVKFLIYDSVLPWALDMARNKGIEGGPFFTQSCAVTAVLYHAAQGAFQVPVEEYDQAAVSLPSLENLEFNDLPSFVSDAGSYPAIRELLLGHLKLK
CELLFLHNIVVNWMRINKWPIKPIGPMIPSMFLDKRLGYDKDYGLNLFKPNSDACMKWMDLKEPGSVVYVSFGSLAAVGEEQMAELAWVLAHKLVGCFMT
HCGWNSTLEALSLGVPMVAMPQWTDQPTNAKYITDVGHVRVRVNVNEKGIVTKEEVERYIREVMESERSNAIRGNFDKWKKLAQTAVDIGGSSDKNIEEF
VTEVACTSQRYRKVRHLLS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G05680 UGT74E2 Uridine diphosphate glycosyltr... Potri.007G140700 0 1
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.003G015900 15.00 0.9373
AT4G00350 MATE efflux family protein (.1... Potri.017G016450 21.86 0.8477
AT4G30950 FADC, SFD4, FAD... STEAROYL DESATURASE DEFICIENCY... Potri.018G107700 22.58 0.9225
Potri.003G013400 27.38 0.8782
AT5G45160 Root hair defective 3 GTP-bind... Potri.012G116000 27.94 0.8787
AT1G47890 AtRLP7 receptor like protein 7 (.1) Potri.016G120466 31.78 0.8731
AT3G53480 PIS1, ABCG37, P... polar auxin transport inhibito... Potri.008G098850 31.84 0.9220
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.003G017566 36.18 0.9080
AT1G15170 MATE efflux family protein (.1... Potri.008G126500 36.33 0.8508
AT3G60300 RWD domain-containing protein ... Potri.014G048000 38.52 0.9047

Potri.007G140700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.