Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ZOG1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05680 237 / 5e-77 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1) AT1G05675 233 / 2e-75 UDP-Glycosyltransferase superfamily protein (.1) AT2G31750 226 / 4e-73 UGT74D1 UDP-glucosyl transferase 74D1 (.1) AT2G31790 219 / 4e-70 UDP-Glycosyltransferase superfamily protein (.1) AT2G43820 205 / 1e-64 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) AT2G43840 204 / 2e-64 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2) AT1G24100 186 / 3e-57 UGT74B1 UDP-glucosyl transferase 74B1 (.1) AT1G05560 159 / 4e-47 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP-glucosyltransferase 75B1 (.1) AT1G05530 157 / 3e-46 UGT75B2, UGT2 UDP-GLUCOSYL TRANSFERASE 2, UDP-glucosyl transferase 75B2 (.1) AT3G21560 152 / 3e-44 UGT84A2 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G179300 [exp] 331 / 7e-114 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032700 [exp] 315 / 1e-107 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032733 [exp] 315 / 1e-107 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032300 [exp] 315 / 1e-107 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G032500 [exp] 312 / 2e-106 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.007G140300 [exp] 288 / 5e-97 AT1G05680 457 / 4e-159 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.001G389200 [exp] 266 / 2e-88 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.014G175000 [exp] 235 / 3e-76 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2) Potri.007G140500 [exp] 229 / 5e-74 AT2G43840 463 / 3e-161 UDP-glycosyltransferase 74 F1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008742 [exp] 222 / 4e-71 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2) Lus10006351 [exp] 211 / 1e-68 AT1G05680 315 / 9e-106 Uridine diphosphate glycosyltransferase 74E2 (.1) Lus10014148 [exp] 214 / 6e-68 AT2G43840 407 / 2e-139 UDP-glycosyltransferase 74 F1 (.1.2) Lus10020556 [exp] 209 / 4e-66 AT2G43820 472 / 1e-164 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10006721 [exp] 208 / 6e-66 AT2G43820 392 / 9e-134 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10009412 [exp] 207 / 1e-65 AT2G43820 474 / 1e-165 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10024486 [exp] 206 / 5e-65 AT1G05680 389 / 4e-132 Uridine diphosphate glycosyltransferase 74E2 (.1) Lus10010468 [exp] 206 / 8e-65 AT1G05675 368 / 7e-124 UDP-Glycosyltransferase superfamily protein (.1) Lus10006353 [exp] 201 / 4e-63 AT2G43820 398 / 1e-135 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10020559 [exp] 200 / 2e-62 AT2G43820 436 / 3e-150 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [poplar] [flax] GT-B PF00201 [poplar] [flax] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Potri.007G141700.1 pacid=42765131 polypeptide=Potri.007G141700.1.p locus=Potri.007G141700 ID=Potri.007G141700.1.v4.1 annot-version=v4.1 ATGGCAGAAATTGCTTGGGGCCTAAAGAGGAGTGACTGCTGCTTCTTGTGGGTAGTCAGAGAATCGGAAAGGAAAAAACTTCCAACCAACTTTGTGGAGG AGTCATCAGAGAAGGGTCTGATTGTGACCTGGAGCCCGCAGCTAGAGGTTCTGGCTCACAAGTCTGTCGGTTGCTTCATGACTCATTGTGGGTGGAACTC AACACTCGAGGCATTGAGCTTAGGAGTGCCAATGGTGGCAATGCCACACTGGACTGATCAACCAACAAATGCAAAGTGCATTGCCGATGTTTGGCATGTA GGGGTTAGAGTGAAGGAAAATGAAAAGGGGATTGTCACAAAAGAAGAGGTAGAAGGGTGTATAAGGGAAGTGATGGAAGGTGAAAGAGGGAATGAGATGA GAAGGAACTCTGAGAAATGGATGAAACTAGCCAAAACAGCAGTAGATGAAGGCGGAAGCTCTGATAAGAATATTACGGAATTTGCAGCAGAACTTGCAAG GAAGTTCCATGAAACCAAAGATTCAAAAGTGTGA
AA sequence Show only first row Show all	>Potri.007G141700.1 pacid=42765131 polypeptide=Potri.007G141700.1.p locus=Potri.007G141700 ID=Potri.007G141700.1.v4.1 annot-version=v4.1 MAEIAWGLKRSDCCFLWVVRESERKKLPTNFVEESSEKGLIVTWSPQLEVLAHKSVGCFMTHCGWNSTLEALSLGVPMVAMPHWTDQPTNAKCIADVWHV GVRVKENEKGIVTKEEVEGCIREVMEGERGNEMRRNSEKWMKLAKTAVDEGGSSDKNITEFAAELARKFHETKDSKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Potri.007G141700 [exp]	0	1	Pt-ZOG1.2
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Potri.012G101100 [exp]	2.82	0.9414
AT2G28490			RmlC-like cupins superfamily p...		Potri.009G054700 [exp]	11.48	0.9290
AT5G19600		SULTR3;5	sulfate transporter 3;5 (.1)		Potri.006G156038 [exp]	14.49	0.9351
AT3G17790		ATACP5, ATPAP17...	purple acid phosphatase 17 (.1...		Potri.010G101900 [exp]	22.47	0.9316
					Potri.013G111566 [exp]	25.51	0.9196
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G024900 [exp]	27.16	0.9315
AT5G61850	LFY	LFY3, LFY	LEAFY 3, floral meristem ident...		Potri.015G106900 [exp]	29.22	0.8904	Pt-LEAFY.1
AT5G19600		SULTR3;5	sulfate transporter 3;5 (.1)		Potri.006G158900 [exp]	29.34	0.9308
AT4G27300			S-locus lectin protein kinase ...		Potri.011G126251 [exp]	29.79	0.9044
AT1G57790			F-box family protein (.1)		Potri.012G106750 [exp]	32.31	0.9279

Compare expression of checked genes

Potri.007G141700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.