Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05675 272 / 2e-89 UDP-Glycosyltransferase superfamily protein (.1) AT2G31750 270 / 6e-89 UGT74D1 UDP-glucosyl transferase 74D1 (.1) AT1G05680 269 / 3e-88 UGT74E2 Uridine diphosphate glycosyltransferase 74E2 (.1) AT2G43840 235 / 2e-75 UGT74F1 UDP-glycosyltransferase 74 F1 (.1.2) AT2G31790 235 / 3e-75 UDP-Glycosyltransferase superfamily protein (.1) AT1G24100 229 / 1e-72 UGT74B1 UDP-glucosyl transferase 74B1 (.1) AT2G43820 226 / 7e-72 SGT1, ATSAGT1, GT, UGT74F2 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) AT2G23260 171 / 2e-50 UGT84B1 UDP-glucosyl transferase 84B1 (.1) AT4G15480 168 / 3e-49 UGT84A1 UDP-Glycosyltransferase superfamily protein (.1) AT1G22380 161 / 2e-46 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G179300 [exp] 475 / 3e-169 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.007G140300 [exp] 428 / 8e-151 AT1G05680 457 / 4e-159 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032300 [exp] 398 / 5e-139 AT1G05675 465 / 6e-162 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G032500 [exp] 392 / 2e-136 AT1G05680 446 / 1e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032733 [exp] 390 / 9e-136 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.017G032700 [exp] 390 / 9e-136 AT1G05680 444 / 6e-154 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.001G389200 [exp] 327 / 1e-110 AT1G05680 494 / 2e-173 Uridine diphosphate glycosyltransferase 74E2 (.1) Potri.014G175000 [exp] 275 / 9e-91 AT2G43840 411 / 8e-141 UDP-glycosyltransferase 74 F1 (.1.2) Potri.007G117200 [exp] 241 / 2e-77 AT2G43840 461 / 1e-160 UDP-glycosyltransferase 74 F1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006353 [exp] 274 / 4e-90 AT2G43820 398 / 1e-135 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10008742 [exp] 271 / 8e-89 AT2G43840 478 / 6e-167 UDP-glycosyltransferase 74 F1 (.1.2) Lus10024486 [exp] 268 / 5e-88 AT1G05680 389 / 4e-132 Uridine diphosphate glycosyltransferase 74E2 (.1) Lus10014148 [exp] 254 / 2e-82 AT2G43840 407 / 2e-139 UDP-glycosyltransferase 74 F1 (.1.2) Lus10006351 [exp] 248 / 5e-82 AT1G05680 315 / 9e-106 Uridine diphosphate glycosyltransferase 74E2 (.1) Lus10006721 [exp] 249 / 1e-80 AT2G43820 392 / 9e-134 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1) Lus10010712 [exp] 243 / 3e-78 AT1G24100 462 / 1e-160 UDP-glucosyl transferase 74B1 (.1) Lus10039041 [exp] 243 / 3e-78 AT1G05675 343 / 3e-114 UDP-Glycosyltransferase superfamily protein (.1) Lus10017825 [exp] 242 / 1e-77 AT2G43840 392 / 2e-133 UDP-glycosyltransferase 74 F1 (.1.2) Lus10006352 [exp] 241 / 2e-77 AT2G43820 414 / 6e-142 UDP-glucose:salicylic acid glucosyltransferase 1, Arabidopsis thaliana salicylic acid glucosyltransferase 1, UDP-glucosyltransferase 74F2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [poplar] [flax] GT-B PF00201 [poplar] [flax] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Potri.007G141900.2 pacid=42766405 polypeptide=Potri.007G141900.2.p locus=Potri.007G141900 ID=Potri.007G141900.2.v4.1 annot-version=v4.1 ATGCAGCTAAAGATTCCACCAGAGAAGTTGCTGGTAACAGTTTCACGTTTGCCAGCACTTTCACCACTAGAGATTACCGATCTACCATCATTCGTGCAAG GTATGGATTCAGAATCAGAATATTCATTTCTACTGAACCATGTGGTCGGTCAGTTTTCGAATTTCAGGGAAGCTGATTGGATCTTTGTCAACACTTCCAG CACCCTGGAGGAAGAGGCGGTAAACTGGCTGGCAAGCCAAAGGTCAATAAAGCCAATAGGACCATTGATCCCATCATTTTACTTGGACAAGCAGCTGGAG GACGATAAAGAGTACGGTCCCAGCCTCTTCAAACCCAATCCGGACGGTTGCAATGAGTGGCTAGATTCAAAGGAAACTGGCTCAGTGGTTTATGTGTCAT TTGGAAGCATGGCTGCACTGGGAGACGAGCAAATGGCAGAAATTGCTTGGGGGCTAAAGAGGAGTGACTGCTGCTTCTTGTGGGTAGTCAGAGAATCGGA AAGGAAAAAACTTCCAAGCAACTTTGTGGAGAAGTCATCAAAGAAATCTCTGCTTGTGACCTGGAGCCCGCAGCTAGAGGTTCTGGCTCACAAGTCTGTT GGTTGCTTCATGACTCATTGTGGGTGGAACTTAACACTCGAGGCGTTGAGCTTAGGAGTGCCAATGGTGGCAATGCCACACTGGACTGATCAACCAACAA ATGCAAAGTGCATTGCCGATGTTTGGCATGTAGGCGTTAGAGTGAAGGCAAATGAATAG
AA sequence Show only first row Show all	>Potri.007G141900.2 pacid=42766405 polypeptide=Potri.007G141900.2.p locus=Potri.007G141900 ID=Potri.007G141900.2.v4.1 annot-version=v4.1 MQLKIPPEKLLVTVSRLPALSPLEITDLPSFVQGMDSESEYSFLLNHVVGQFSNFREADWIFVNTSSTLEEEAVNWLASQRSIKPIGPLIPSFYLDKQLE DDKEYGPSLFKPNPDGCNEWLDSKETGSVVYVSFGSMAALGDEQMAEIAWGLKRSDCCFLWVVRESERKKLPSNFVEKSSKKSLLVTWSPQLEVLAHKSV GCFMTHCGWNLTLEALSLGVPMVAMPHWTDQPTNAKCIADVWHVGVRVKANE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G05675			UDP-Glycosyltransferase superf...		Potri.007G141900 [exp]	0	1
AT5G42830			HXXXD-type acyl-transferase fa...		Potri.014G025600 [exp]	9.27	0.8683
AT4G16380			Heavy metal transport/detoxifi...		Potri.006G020100 [exp]	11.91	0.7884
AT5G08240			unknown protein		Potri.005G092400 [exp]	15.29	0.8502
					Potri.014G030500 [exp]	15.49	0.8344
AT1G27170			transmembrane receptors;ATP bi...		Potri.017G143566 [exp]	18.70	0.8405
					Potri.014G049000 [exp]	20.49	0.8245
AT5G16560	GARP	KAN1, KAN	KANADI 1, KANADI, Homeodomain-...		Potri.017G137600 [exp]	21.93	0.8315
					Potri.012G121044 [exp]	23.02	0.8530
AT1G76410		ATL8	RING/U-box superfamily protein...		Potri.002G006400 [exp]	23.13	0.7719
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Potri.013G047950 [exp]	23.81	0.8590

Compare expression of checked genes

Potri.007G141900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.