Potri.007G142200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44065 197 / 9e-64 Ribosomal protein L2 family (.1.2)
ATCG01310 105 / 1e-27 ATCG01310.1, RPL2.2 ribosomal protein L2 (.1)
ATCG00830 105 / 1e-27 ATCG00830.1, RPL2.1 ribosomal protein L2 (.1)
AT3G51190 84 / 1e-19 Ribosomal protein L2 family (.1)
AT2G18020 72 / 3e-15 EMB2296 embryo defective 2296, Ribosomal protein L2 family (.1)
AT4G36130 71 / 1e-14 Ribosomal protein L2 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G007700 292 / 2e-101 AT2G44065 200 / 3e-65 Ribosomal protein L2 family (.1.2)
Potri.013G137077 100 / 8e-27 ATCG01310 243 / 2e-82 ribosomal protein L2 (.1)
Potri.011G074401 73 / 3e-15 ATCG01310 376 / 2e-131 ribosomal protein L2 (.1)
Potri.007G013101 71 / 2e-14 AT4G36130 493 / 3e-179 Ribosomal protein L2 family (.1)
Potri.007G013000 71 / 2e-14 AT4G36130 493 / 3e-179 Ribosomal protein L2 family (.1)
Potri.005G115700 71 / 2e-14 AT4G36130 492 / 5e-179 Ribosomal protein L2 family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001572 211 / 4e-69 AT2G44065 238 / 8e-80 Ribosomal protein L2 family (.1.2)
Lus10004973 216 / 6e-65 AT1G07510 815 / 0.0 FTSH protease 10 (.1)
Lus10001687 100 / 6e-26 ATCG00830 281 / 3e-96 ribosomal protein L2 (.1)
Lus10025966 72 / 5e-15 AT4G36130 499 / 0.0 Ribosomal protein L2 family (.1)
Lus10028468 72 / 6e-15 AT4G36130 495 / 4e-180 Ribosomal protein L2 family (.1)
Lus10041923 71 / 2e-14 AT4G36130 502 / 0.0 Ribosomal protein L2 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain
Representative CDS sequence
>Potri.007G142200.1 pacid=42766835 polypeptide=Potri.007G142200.1.p locus=Potri.007G142200 ID=Potri.007G142200.1.v4.1 annot-version=v4.1
ATGGCTCTATGGAGCAGAGCTCGCACAGCTTCTTCTTCACTCTTCAACAGGGTCCTTCAACATCCCAACAACATCAACAACAGCAGCAGCAACATCACCA
ATACCACTGCTTTTCTCCGCCTTTTCTCCGCCAATGTAGCTGGAAATGCTAATTCACTGCGTGGGGACATGATGAAACAACTTCTGCATCTCGATATCAA
TTCGCAAATTGGAAGTTGCATGCCTCTTGGTGCTATGCGTATTGGAACGATAATACATAACATTGAGTTGAACCCCGGTCAAGGTGGCAAGATGGTTCGA
GCTGCAGGTACTAGTGCAAAGATTCTGAAAGAGCCATCACCAACCATCACTGTGGTGCAGCTGCCTTCAGGTGTTGTGAAAAAGATCGATTCAAGGTGTC
GGGCTACAATTGGCATTGTTTCGAACCCCAGCCACAAGGATCGAAAGCTTAGGAAGGCTGGACAGAGCCGGTGGTTGGGTCGAAGACCAACAGTTAGAGG
AGTGGCAATGAATCCAGTAGATCATCCTCATGGTGGCGGTGAGGGTCGGAGCAAAAGTAGTGGGTCCTTGGGAAGGGTGTCCCAAACACCATGGGGCAAG
CCAACTAAAGGTGGGTACAAGACTGGTCCACTCAAGCGCAGAAAGTAG
AA sequence
>Potri.007G142200.1 pacid=42766835 polypeptide=Potri.007G142200.1.p locus=Potri.007G142200 ID=Potri.007G142200.1.v4.1 annot-version=v4.1
MALWSRARTASSSLFNRVLQHPNNINNSSSNITNTTAFLRLFSANVAGNANSLRGDMMKQLLHLDINSQIGSCMPLGAMRIGTIIHNIELNPGQGGKMVR
AAGTSAKILKEPSPTITVVQLPSGVVKKIDSRCRATIGIVSNPSHKDRKLRKAGQSRWLGRRPTVRGVAMNPVDHPHGGGEGRSKSSGSLGRVSQTPWGK
PTKGGYKTGPLKRRK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44065 Ribosomal protein L2 family (.... Potri.007G142200 0 1
AT5G22280 unknown protein Potri.016G073500 11.35 0.7273
AT4G27750 ISI1 IMPAIRED SUCROSE INDUCTION 1, ... Potri.015G029300 11.48 0.6191
AT1G04290 Thioesterase superfamily prote... Potri.004G134132 12.64 0.7170
AT5G50930 Histone superfamily protein (.... Potri.015G105900 19.77 0.6707
AT3G03980 NAD(P)-binding Rossmann-fold s... Potri.019G033500 23.36 0.6930
AT3G15660 ATGRX4 A. THALIANA GLUTAREDOXIN 4, gl... Potri.003G060600 25.65 0.6740
AT4G28830 S-adenosyl-L-methionine-depend... Potri.018G083800 31.74 0.6887
AT1G26665 Mediator complex, subunit Med1... Potri.003G146900 33.68 0.7121
AT5G49480 ACP1, ATCP1 Ca2+-binding protein 1, Ca2+-b... Potri.010G146900 35.35 0.6605 Pt-CP1.1
AT1G55340 Protein of unknown function (D... Potri.013G057600 45.36 0.6894

Potri.007G142200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.