Potri.007G142700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G143300 229 / 1e-69 AT5G36930 519 / 2e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.007G143200 165 / 2e-48 AT5G36930 81 / 1e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T011750 64 / 4e-12 AT5G36930 551 / 2e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G017082 58 / 5e-10 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.001G066500 58 / 6e-10 AT5G36930 462 / 2e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G016425 57 / 1e-09 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G052000 57 / 2e-09 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T001500 56 / 3e-09 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G021681 56 / 4e-09 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.007G142700.1 pacid=42764931 polypeptide=Potri.007G142700.1.p locus=Potri.007G142700 ID=Potri.007G142700.1.v4.1 annot-version=v4.1
ATGGCAATGAAAGAATATTGTGAAGATGAGGAATTGGAACTGTGCGTGGGACTTTATACGGGAGAAGACGCTGAAGTGTTTGAATGTGGGATCCATGTGA
TAGTTGAAAAGACAGATTCATTTGAAGGGTCAGAGTGGGATCATGAGTCTGAAGGTGGAAGAGATAGAGTAATACCTGCACCACCATATCTGTCTCAATA
TGCGCGTTACAATTTCTTTGAGATTTACGGCAAGCAAGGTCTCAGTAATTTATCAAAAAATACCAAGGATCGGCTTCTTGAGAGAATCTTCAATTATCAT
TTTCTCGAGTATTTTATTCCCTTCAAGGCTTATTTCGTTCCCTACGATTATTCTATCATTCCAAAATGGTTCAGCTACGGTGCAGAAGGATGTTCATTAT
CATTTGATATACCTCCAGATTTCGAAGGCTTGGTCATTTGGGCTGTCTGTTCAGGTGGTGGGCATCAAGAATTCAAGGCTATTATAAAAAATAAAAGCAA
CAGTCCGAAGTTGAAAGCGATAGAACGATACCTTCGCCACCATATCATCTGCTTCACCATCCCCGTCATGGTTCAATGA
AA sequence
>Potri.007G142700.1 pacid=42764931 polypeptide=Potri.007G142700.1.p locus=Potri.007G142700 ID=Potri.007G142700.1.v4.1 annot-version=v4.1
MAMKEYCEDEELELCVGLYTGEDAEVFECGIHVIVEKTDSFEGSEWDHESEGGRDRVIPAPPYLSQYARYNFFEIYGKQGLSNLSKNTKDRLLERIFNYH
FLEYFIPFKAYFVPYDYSIIPKWFSYGAEGCSLSFDIPPDFEGLVIWAVCSGGGHQEFKAIIKNKSNSPKLKAIERYLRHHIICFTIPVMVQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.007G142700 0 1
AT2G25770 Polyketide cyclase/dehydrase a... Potri.018G046100 5.38 0.8881
Potri.004G019766 8.00 0.8866
AT5G36930 Disease resistance protein (TI... Potri.011G008228 16.79 0.8746
AT5G17680 disease resistance protein (TI... Potri.019G070651 34.92 0.8655
Potri.011G053612 35.49 0.7882
AT5G38560 AtPERK8 proline-rich extensin-like rec... Potri.017G110400 39.11 0.8028
AT5G36930 Disease resistance protein (TI... Potri.011G009251 42.56 0.8610
AT1G23870 ATTPS9 TREHALOSE -6-PHOSPHATASE SYNTH... Potri.012G078500 46.73 0.8089 Pt-TPS8.1
AT1G49800 unknown protein Potri.001G299800 58.39 0.7768
Potri.003G070000 65.45 0.8121

Potri.007G142700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.