Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16970 99 / 1e-25 AT-AER alkenal reductase (.1) AT3G03080 96 / 1e-24 Zinc-binding dehydrogenase family protein (.1) AT5G16990 95 / 2e-24 Zinc-binding dehydrogenase family protein (.1) AT5G17000 94 / 1e-23 Zinc-binding dehydrogenase family protein (.1) AT1G26320 91 / 7e-23 Zinc-binding dehydrogenase family protein (.1.2) AT5G38000 90 / 3e-22 Zinc-binding dehydrogenase family protein (.1) AT5G37940 89 / 8e-22 Zinc-binding dehydrogenase family protein (.1) AT5G37980 89 / 9e-22 Zinc-binding dehydrogenase family protein (.1) AT5G16960 79 / 3e-18 Zinc-binding dehydrogenase family protein (.1) AT3G59845 72 / 6e-16 Zinc-binding dehydrogenase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G002700 [exp] 107 / 1e-28 AT1G26320 490 / 4e-175 Zinc-binding dehydrogenase family protein (.1.2) Potri.017G002300 [exp] 106 / 2e-28 AT1G26320 488 / 2e-174 Zinc-binding dehydrogenase family protein (.1.2) Potri.007G142400 [exp] 98 / 2e-25 AT5G16990 491 / 1e-175 Zinc-binding dehydrogenase family protein (.1) Potri.007G143600 [exp] 96 / 1e-24 AT5G16970 501 / 1e-179 alkenal reductase (.1) Potri.017G006000 [exp] 96 / 3e-24 AT5G37980 493 / 2e-176 Zinc-binding dehydrogenase family protein (.1) Potri.017G004032 [exp] 91 / 4e-24 AT5G16970 159 / 2e-48 alkenal reductase (.1) Potri.007G143700 [exp] 95 / 5e-24 AT5G16970 495 / 2e-177 alkenal reductase (.1) Potri.017G004800 [exp] 93 / 9e-24 AT5G16970 409 / 8e-144 alkenal reductase (.1) Potri.017G005700 [exp] 94 / 2e-23 AT1G26320 496 / 1e-176 Zinc-binding dehydrogenase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036289 [exp] 82 / 2e-19 AT5G16990 463 / 1e-164 Zinc-binding dehydrogenase family protein (.1) Lus10004379 [exp] 81 / 4e-19 AT5G17000 487 / 4e-174 Zinc-binding dehydrogenase family protein (.1) Lus10004380 [exp] 79 / 2e-18 AT5G37980 477 / 4e-170 Zinc-binding dehydrogenase family protein (.1) Lus10010989 [exp] 79 / 4e-18 AT5G16990 483 / 2e-172 Zinc-binding dehydrogenase family protein (.1) Lus10040177 [exp] 78 / 6e-18 AT5G37980 480 / 3e-171 Zinc-binding dehydrogenase family protein (.1) Lus10010988 [exp] 77 / 1e-17 AT5G16990 486 / 6e-174 Zinc-binding dehydrogenase family protein (.1) Lus10003638 [exp] 76 / 1e-17 AT3G03080 356 / 8e-124 Zinc-binding dehydrogenase family protein (.1) Lus10040589 [exp] 76 / 7e-17 AT1G65560 446 / 3e-156 Zinc-binding dehydrogenase family protein (.1) Lus10007832 [exp] 75 / 8e-17 AT5G16990 464 / 3e-165 Zinc-binding dehydrogenase family protein (.1) Lus10007853 [exp] 74 / 1e-16 AT5G16990 468 / 3e-166 Zinc-binding dehydrogenase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.007G143250.1 pacid=42766335 polypeptide=Potri.007G143250.1.p locus=Potri.007G143250 ID=Potri.007G143250.1.v4.1 annot-version=v4.1 ATGGATAAAAAGCTAGCAGAAACAGTTTGGGATGAAGAAGTAGCTAACAAGCAGGTGATATTGAAGAACTATGTCATCTCGTGTCTGCCTAAGAAATCAG ACGTGGAGGTGATCGCTAGTACCATCAAACTTAAGGTACCAGAAGAAACTCCTGGAATTCTAGTCAAGAATCTGTATTTGTCTTATATCGATTCCTACAT GCCCGGTTTGCCTTTAAATGGAAATGGGGTGGCTGGAGCTCTGGATTCAGGTCATCCAGACTACAGGAAAGGTGACCTGATTTGGGAAGAGCACAGTCTC ATTACAGAAACAAAGGGGCTGTTCAAAATTCAACACACAGGTTGCTGTAGTGCTACTGAAATCCATGGACGGAAAGTGTGA
AA sequence Show only first row Show all	>Potri.007G143250.1 pacid=42766335 polypeptide=Potri.007G143250.1.p locus=Potri.007G143250 ID=Potri.007G143250.1.v4.1 annot-version=v4.1 MDKKLAETVWDEEVANKQVILKNYVISCLPKKSDVEVIASTIKLKVPEETPGILVKNLYLSYIDSYMPGLPLNGNGVAGALDSGHPDYRKGDLIWEEHSL ITETKGLFKIQHTGCCSATEIHGRKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G16970		AT-AER	alkenal reductase (.1)		Potri.007G143250 [exp]	0	1
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G172200 [exp]	2.00	0.9182
AT5G26594		ARR24	response regulator 24 (.1)		Potri.003G172932 [exp]	7.14	0.8902
AT1G64660		ATMGL	methionine gamma-lyase (.1)		Potri.003G146600 [exp]	11.31	0.8863
					Potri.007G088800 [exp]	20.63	0.8703
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Potri.006G186000 [exp]	21.63	0.8251
AT1G13680			PLC-like phosphodiesterases su...		Potri.004G117500 [exp]	22.13	0.8664
					Potri.017G046301 [exp]	24.08	0.8056
AT4G01240			S-adenosyl-L-methionine-depend...		Potri.004G116900 [exp]	25.88	0.8342
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182800 [exp]	30.59	0.8184
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Potri.006G186100 [exp]	31.93	0.8147

Compare expression of checked genes

Potri.007G143250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.