Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48380 162 / 2e-47 BIR1 BAK1-interacting receptor-like kinase 1 (.1) AT1G27190 144 / 1e-40 Leucine-rich repeat protein kinase family protein (.1) AT5G07280 132 / 3e-36 EXS, EMS1 EXTRA SPOROGENOUS CELLS, EXCESS MICROSPOROCYTES1, Leucine-rich repeat transmembrane protein kinase (.1) AT3G28450 125 / 1e-33 Leucine-rich repeat protein kinase family protein (.1) AT1G69990 123 / 4e-33 Leucine-rich repeat protein kinase family protein (.1) AT2G02220 120 / 7e-32 ATPSKR1 phytosulfokin receptor 1 (.1) AT4G39400 119 / 1e-31 DWF2, CBB2, BIN1, BRI1, ATBRI1 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1) AT4G01330 118 / 2e-31 Protein kinase superfamily protein (.1.2) AT1G01540 116 / 2e-31 Protein kinase superfamily protein (.1.2) AT4G20140 118 / 4e-31 GSO1 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G004900 [exp] 241 / 4e-79 AT5G48380 262 / 2e-81 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G003601 [exp] 229 / 5e-76 AT5G48380 255 / 3e-80 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G004216 [exp] 237 / 2e-75 AT5G48380 412 / 2e-136 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G003800 [exp] 234 / 6e-75 AT5G48380 455 / 1e-153 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G003251 [exp] 205 / 2e-65 AT5G48380 280 / 1e-88 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G005001 [exp] 196 / 2e-63 AT5G48380 229 / 7e-71 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G004400 [exp] 186 / 1e-57 AT5G48380 221 / 1e-65 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G003400 [exp] 185 / 2e-57 AT5G48380 209 / 1e-61 BAK1-interacting receptor-like kinase 1 (.1) Potri.017G007600 [exp] 184 / 3e-57 AT5G48380 208 / 5e-61 BAK1-interacting receptor-like kinase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034279 [exp] 188 / 3e-60 AT5G48380 213 / 1e-64 BAK1-interacting receptor-like kinase 1 (.1) Lus10002147 [exp] 164 / 6e-48 AT5G48380 755 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10008743 [exp] 162 / 3e-47 AT5G48380 764 / 0.0 BAK1-interacting receptor-like kinase 1 (.1) Lus10030811 [exp] 138 / 3e-38 AT1G27190 772 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10040459 [exp] 122 / 1e-33 AT4G34500 549 / 0.0 Protein kinase superfamily protein (.1) Lus10033533 [exp] 124 / 2e-33 AT4G39400 1492 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1) Lus10020835 [exp] 124 / 3e-33 AT4G39400 1486 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1) Lus10007919 [exp] 122 / 3e-33 AT1G01540 751 / 0.0 Protein kinase superfamily protein (.1.2) Lus10036386 [exp] 122 / 4e-33 AT1G01540 748 / 0.0 Protein kinase superfamily protein (.1.2) Lus10013288 [exp] 118 / 4e-33 AT1G27190 390 / 2e-133 Leucine-rich repeat protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.007G144000.1 pacid=42765644 polypeptide=Potri.007G144000.1.p locus=Potri.007G144000 ID=Potri.007G144000.1.v4.1 annot-version=v4.1 ATGGGAACCATGTACAAGGCTACCCTTCCTAATGGTTGGTTCGTTGCGGAGAAGAGAATGCATGATTCTCGACACTTTGAGGAACATATGGTATCAGAAT TGAAAACATTGGGCAGATTGAGACATAATAACTTGCTGCCACTGCTAGGATTCTGCATAGAATCAAAGGAAAGGCTTCTGGTGTACAAGTATATATCAAA TGGAAAACTTTTCGATTGGCTGCATTCTGTGGAAGCCCAGAAGAAGATTCTGGAATGGCCTTTGACGGTGAAAATAGCAGTTGGTGTAGCAAGAGGCCTG GCATGGCTCCACCATGGCTACAATGCCCGCGTGGTGCATCTCAACATAAATTCAAGGAGTATTTTACTTGATAGGAATTTTGAACCCAAGTTATCAAATT TCGGAGAAGCGATGCTCAGGATTTCGACTAAGAGTTCACGTGTGAATAGTGATTTTTGGGAGATGGCATTTGTTAAGGAAGATGTGCATGGATATGGAGT TAGGGAAAGCGAGTAG
AA sequence Show only first row Show all	>Potri.007G144000.1 pacid=42765644 polypeptide=Potri.007G144000.1.p locus=Potri.007G144000 ID=Potri.007G144000.1.v4.1 annot-version=v4.1 MGTMYKATLPNGWFVAEKRMHDSRHFEEHMVSELKTLGRLRHNNLLPLLGFCIESKERLLVYKYISNGKLFDWLHSVEAQKKILEWPLTVKIAVGVARGL AWLHHGYNARVVHLNINSRSILLDRNFEPKLSNFGEAMLRISTKSSRVNSDFWEMAFVKEDVHGYGVRESE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.007G144000 [exp]	0	1
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Potri.008G048500 [exp]	1.00	0.9904
AT1G55570		SKS12	SKU5 similar 12 (.1)		Potri.001G000500 [exp]	6.92	0.9135
					Potri.018G132951 [exp]	15.87	0.9269
AT3G27785	MYB	PGA37, ATMYB118	PLANT GROWTH ACTIVATOR 37, myb...		Potri.001G347200 [exp]	16.97	0.8833
AT1G24590	AP2_ERF	ESR2, DRNL, SOB...	FOR SUPPRESSOR OF PHYTOCHROMEB...		Potri.010G046600 [exp]	22.84	0.9343
AT5G62420			NAD(P)-linked oxidoreductase s...		Potri.001G125400 [exp]	29.12	0.8405
					Potri.001G225804 [exp]	30.65	0.8556
AT5G15310	MYB	ATMYB16, ATMIXT...	myb domain protein 16 (.1.2)		Potri.008G089700 [exp]	31.38	0.9281
AT3G09870			SAUR-like auxin-responsive pro...		Potri.006G125100 [exp]	35.88	0.9260
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.017G040700 [exp]	40.02	0.9251

Compare expression of checked genes

Potri.007G144000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.