Potri.007G144701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43980 145 / 1e-41 ATITPK4 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
AT5G16760 43 / 3e-05 AtITPK1 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G007500 203 / 9e-64 AT2G43980 534 / 0.0 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
Potri.001G140000 49 / 2e-07 AT5G16760 372 / 6e-129 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
Potri.003G094100 48 / 9e-07 AT5G16760 373 / 2e-129 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006145 146 / 3e-43 AT2G43980 317 / 1e-105 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
Lus10033768 140 / 2e-40 AT2G43980 395 / 4e-135 "inositol 1,3,4-trisphosphate 5/6-kinase 4", inositol 1,3,4-trisphosphate 5/6-kinase 4 (.1)
Lus10035811 46 / 4e-06 AT5G16760 311 / 1e-105 inositol \(1,3,4\) P3 5/6-kinase 1, Arabidopsis thaliana inositol \(1,3,4\) P3 5/6-kinase 1, Inositol 1,3,4-trisphosphate 5/6-kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0179 ATP-grasp PF05770 Ins134_P3_kin Inositol 1,3,4-trisphosphate 5/6-kinase ATP-grasp domain
Representative CDS sequence
>Potri.007G144701.6 pacid=42765769 polypeptide=Potri.007G144701.6.p locus=Potri.007G144701 ID=Potri.007G144701.6.v4.1 annot-version=v4.1
ATGGCAATCATCTGTGGAGTTGAAGATTTTAAAGATTTAAATATTCCTCTTCCAGCAATTGTTCAGGAGTACGTGGACCATTTATCTAATATATTCAAGA
TTTATGTCTTGGGTGAGCGACTTTTCTATGCGGTAAAAAAATCTATACCAAATGTTAATGTCTTGACCAAATCATCTGAAAGAAATGAACTCGGACCTTT
ACTCTTTGACAGCTTAAAATCTCTACCCATCAGTACTGAGCACTATACAGATGCAGATTCCTTCAAGACCAATATTCATTCTTTTGATCTTGAGCTGGTC
ACTGATGCTGTGAATTGGCTTGCAAGAAAACTTGATCTTACCATCTTTGGCTTCGATGCAGTTGCAATAGATTGGCATCCACCATTCCTACTGGATCCAA
TTTTGCTAGGTGTCCATGTTCTTGATATTCCTGTTGTTTGGTCCCTCGAGTCTATTCTCTTCGGTTACATCTTTTTCCGGGCTGCATCATGA
AA sequence
>Potri.007G144701.6 pacid=42765769 polypeptide=Potri.007G144701.6.p locus=Potri.007G144701 ID=Potri.007G144701.6.v4.1 annot-version=v4.1
MAIICGVEDFKDLNIPLPAIVQEYVDHLSNIFKIYVLGERLFYAVKKSIPNVNVLTKSSERNELGPLLFDSLKSLPISTEHYTDADSFKTNIHSFDLELV
TDAVNWLARKLDLTIFGFDAVAIDWHPPFLLDPILLGVHVLDIPVVWSLESILFGYIFFRAAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G43980 ATITPK4 "inositol 1,3,4-trisphosphate ... Potri.007G144701 0 1
Potri.002G169550 4.24 0.8156
Potri.008G164600 4.69 0.8211
AT2G21385 unknown protein Potri.009G121902 8.12 0.7690
AT3G50860 Clathrin adaptor complex small... Potri.005G122900 10.48 0.7978
AT2G01690 ARM repeat superfamily protein... Potri.010G106700 10.67 0.7207
AT3G13410 unknown protein Potri.003G223601 11.48 0.8020
AT3G55330 PPL1 PsbP-like protein 1 (.1) Potri.008G050300 12.68 0.7074
AT2G01050 zinc ion binding;nucleic acid ... Potri.017G002800 15.36 0.5914
AT1G10240 FAR1_related FRS11 FAR1-related sequence 11 (.1) Potri.010G140500 16.24 0.6990
Potri.001G258150 18.70 0.6962

Potri.007G144701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.