Plant FIBer expression Database

Potri.007G146401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G001400
[exp]
68 / 2e-15 AT2G44080 44 / 2e-06 ARGOS-like (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.007G146401.4 pacid=42766788 polypeptide=Potri.007G146401.4.p locus=Potri.007G146401 ID=Potri.007G146401.4.v4.1 annot-version=v4.1
ATGAGTTTCGAACATTCTGAGTCAGAAACAAGAGTGCCAAGAAGTAGAATCAATCTGCAAGACCGTTGTTCTAGCAGCATTATGGATGTGAGAGCAAGAA
AGATCACTACTAACAATCCCCTTGCTACCCCTCCTAATACAAGAGTAGAGAAAAGGAAAATGGAGTATAATCGATCTCTCTCGCAAGGAAGTAGCAGAAG
GTTGTTGACTGCAAGCCATTTCAGCTTGGTATCATTGCTTTTGCTCGTATGTCTTACTGCATCTTTGTTGATTCTTCCCTTGGTACTACCGCCGTTGCCT
CCACCGCCTTTCATGTTACTTCTGCTACCAATAGGCATCTTAGTGTTGCTCATGTTCTTGGCTTTCATGCCTTCTAATGCAAGGGACATAACTTATACAT
GTATGTAA
AA sequence
>Potri.007G146401.4 pacid=42766788 polypeptide=Potri.007G146401.4.p locus=Potri.007G146401 ID=Potri.007G146401.4.v4.1 annot-version=v4.1
MSFEHSESETRVPRSRINLQDRCSSSIMDVRARKITTNNPLATPPNTRVEKRKMEYNRSLSQGSSRRLLTASHFSLVSLLLLVCLTASLLILPLVLPPLP
PPPFMLLLLPIGILVLLMFLAFMPSNARDITYTCM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G59900 ARGOS auxin-regulated gene involved ... Potri.007G146401
[exp]
0 1
AT2G40940 ERS1 ethylene response sensor 1 (.1... Potri.002G201500
[exp]
1.41 0.8081 ERS1.1,ETR1
AT2G35215 unknown protein Potri.003G092100
[exp]
3.46 0.7838
AT5G03730 AtCTR1, SIS1, C... SUGAR-INSENSITIVE 1, CONSTITUT... Potri.006G115800
[exp]
4.47 0.7170
AT3G23150 ETR2 ethylene response 2, Signal tr... Potri.010G074300
[exp]
7.00 0.7285 Pt-ETR2.3
Potri.008G164250
[exp]
9.16 0.7416
AT1G73830 bHLH bHLH050, BEE3 BR enhanced expression 3 (.1.2... Potri.012G055700
[exp]
10.67 0.7451
AT2G26070 RTE1 REVERSION-TO-ETHYLENE SENSITIV... Potri.006G229900
[exp]
17.66 0.6658
AT3G23150 ETR2 ethylene response 2, Signal tr... Potri.008G164400
[exp]
18.11 0.7210 ETR2.2
AT2G39980 HXXXD-type acyl-transferase fa... Potri.010G192400
[exp]
22.22 0.6280
AT2G35215 unknown protein Potri.001G142250
[exp]
27.74 0.6646

Potri.007G146401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.