Potri.008G002200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08410 103 / 2e-28 FTRA2 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
AT5G23440 98 / 3e-26 FTRA1 ferredoxin/thioredoxin reductase subunit A (variable subunit) 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G255500 146 / 5e-45 AT5G08410 78 / 4e-18 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041002 108 / 2e-30 AT5G08410 130 / 8e-39 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
Lus10013448 108 / 2e-30 AT5G08410 130 / 5e-39 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0610 ETAP PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Representative CDS sequence
>Potri.008G002200.1 pacid=42806763 polypeptide=Potri.008G002200.1.p locus=Potri.008G002200 ID=Potri.008G002200.1.v4.1 annot-version=v4.1
ATGAGTACGAGCTTGGCGTTATCGTCGGCTGCCACCGCTGCAGTCAGTTCGGCGTTCCTTGCCACAGATACCAACAAATTCAAATTCAATGCCTTAATTT
CACCAAATCCAAGGCTTAATTGCCGCTACTCAATTATTACTCCTACAGCTACTAGTATAGCAACAAGTAGTAGTAGCAGACGAAGAAGAAAAACTGCTGT
TTCGTGCTCGGTGGCTTTGGGATCCAACAATTCAGATGATGATGATGAAGAAGAAGAAGAAGAAGAAGCGAAGAAGAAGATTGGAGCAAGGGTTAGGGTG
AAGGCCCCGGTGAAGGTTTACCACGTGCCTCGCGTGGCGGAGGAAGTGGATCTGTGTGGATTGGAAGGTGAGGTGAAGCAGTACGTGAGCCAGTGGAAGG
GGAGGCGAGTTTCCGCTAATCTTCCTTACAAGACTCAGTTTGTCCACTCAGGAGGAGTCAAATTCTTTGCTCATCTCAGAGAGGACGAATTGCAATTTAT
TGATTGA
AA sequence
>Potri.008G002200.1 pacid=42806763 polypeptide=Potri.008G002200.1.p locus=Potri.008G002200 ID=Potri.008G002200.1.v4.1 annot-version=v4.1
MSTSLALSSAATAAVSSAFLATDTNKFKFNALISPNPRLNCRYSIITPTATSIATSSSSRRRRKTAVSCSVALGSNNSDDDDEEEEEEEAKKKIGARVRV
KAPVKVYHVPRVAEEVDLCGLEGEVKQYVSQWKGRRVSANLPYKTQFVHSGGVKFFAHLREDELQFID

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G08410 FTRA2 ferredoxin/thioredoxin reducta... Potri.008G002200 0 1
AT3G15580 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ub... Potri.002G189450 1.73 0.9555
AT1G34000 OHP2 one-helix protein 2 (.1) Potri.005G196100 4.00 0.9532 OHP2.1
AT1G28150 unknown protein Potri.004G066900 4.89 0.9501
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Potri.018G028500 14.07 0.9449
AT2G32480 ARASP ARABIDOPSIS SERIN PROTEASE (.1... Potri.002G228600 14.14 0.9450
AT3G19220 CYO1 ,SCO2 SNOWY COTYLEDON 2, SHI-YO-U ME... Potri.009G102400 16.43 0.9412
AT4G34730 ribosome-binding factor A fami... Potri.004G164200 17.17 0.9462
AT3G08010 ATAB2 RNA binding (.1) Potri.009G059600 19.28 0.9461
AT3G54900 ATGRXCP, CXIP1 GLUTAREDOXIN, CAX interacting ... Potri.014G141200 20.68 0.9486
AT5G52420 unknown protein Potri.015G146400 25.23 0.9434

Potri.008G002200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.