Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR49
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24400 113 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT4G31320 101 / 6e-28 SAUR-like auxin-responsive protein family (.1) AT3G43120 64 / 1e-13 SAUR-like auxin-responsive protein family (.1) AT5G20810 63 / 3e-13 SAUR-like auxin-responsive protein family (.1.2) AT1G56150 56 / 9e-11 SAUR-like auxin-responsive protein family (.1) AT3G12830 52 / 2e-09 SAUR-like auxin-responsive protein family (.1) AT1G19840 52 / 3e-09 SAUR-like auxin-responsive protein family (.1) AT3G20220 51 / 5e-09 SAUR-like auxin-responsive protein family (.1) AT1G16510 50 / 1e-08 SAUR-like auxin-responsive protein family (.1) AT3G20210 52 / 2e-08 DELTAVPE, DELTA-VPE delta vacuolar processing enzyme (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G253800 [exp] 150 / 5e-47 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 106 / 6e-30 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.009G125900 [exp] 67 / 1e-14 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1) Potri.004G164300 [exp] 66 / 2e-14 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1) Potri.006G137200 [exp] 62 / 1e-12 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2) Potri.018G063400 [exp] 61 / 1e-12 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2) Potri.005G096400 [exp] 51 / 5e-09 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1) Potri.003G167400 [exp] 52 / 8e-09 AT5G50760 100 / 4e-27 SAUR-like auxin-responsive protein family (.1) Potri.005G237000 [exp] 51 / 8e-09 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035716 [exp] 115 / 1e-32 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1) Lus10037302 [exp] 107 / 5e-29 AT2G24400 150 / 2e-44 SAUR-like auxin-responsive protein family (.1) Lus10026977 [exp] 98 / 2e-26 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10033348 [exp] 97 / 8e-26 AT2G24400 155 / 3e-48 SAUR-like auxin-responsive protein family (.1) Lus10034888 [exp] 61 / 4e-12 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2) Lus10012426 [exp] 56 / 1e-10 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10031178 [exp] 52 / 8e-09 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 50 / 2e-08 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10031754 [exp] 50 / 2e-08 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 49 / 3e-08 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.008G003900.1 pacid=42807641 polypeptide=Potri.008G003900.1.p locus=Potri.008G003900 ID=Potri.008G003900.1.v4.1 annot-version=v4.1 ATGGATCATCCAAAAAAGTGTAGCAAGATCAGCGACATTGTTCGGCCTCAGCAAATCCTCAAGAAATGGAAAAGGGCAGCAAATGCACCAAAGAACAACC ACAACCACAACACTAGCATCAGCAGCAATGCCAGCAAGAGCATCAAGTTCATAAAGAGAACACTTATCTCCTTCACAGATTCTTCATCAGCAGCAGCAGC TGCATCAAATGATGTTGTCCCCAAAGGGTACCTTGCTATTTGCGTTGGCAAGGAGATGAAGAGGTATATCATCCCCACGGAGTACTTGGGTCACCAAGCT TTTGGAATACTGTTGCGAGAGGCCGAAGAGGAGTTTGGGTTTCAACAAGAGGGAGTCTTGAAGATACCATGTGAAGTTCCTGTCTTTGAGAAGATCTTAA AGGTGGTTTAA
AA sequence Show only first row Show all	>Potri.008G003900.1 pacid=42807641 polypeptide=Potri.008G003900.1.p locus=Potri.008G003900 ID=Potri.008G003900.1.v4.1 annot-version=v4.1 MDHPKKCSKISDIVRPQQILKKWKRAANAPKNNHNHNTSISSNASKSIKFIKRTLISFTDSSSAAAAASNDVVPKGYLAICVGKEMKRYIIPTEYLGHQA FGILLREAEEEFGFQQEGVLKIPCEVPVFEKILKVV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G24400			SAUR-like auxin-responsive pro...		Potri.008G003900 [exp]	0	1	SAUR49
AT2G17070			Arabidopsis protein of unknown...		Potri.004G182400 [exp]	16.00	0.5620
AT3G49030			FBD, F-box and Leucine Rich Re...		Potri.011G024300 [exp]	26.83	0.4917
AT1G51400			Photosystem II 5 kD protein (....		Potri.009G052500 [exp]	173.35	0.4121
AT1G43730			RNA-directed DNA polymerase (r...		Potri.004G000150 [exp]	187.34	0.4024
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.017G047300 [exp]	215.73	0.3989

Compare expression of checked genes

Potri.008G003900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.