Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43080 59 / 1e-11 CYCA3;1 Cyclin A3;1 (.1) AT1G47230 55 / 3e-10 CYCA3;4 CYCLIN A3;4 (.1.2) AT1G47210 53 / 1e-09 CYCA3;2 cyclin-dependent protein kinase 3;2 (.1.2) AT1G47220 51 / 7e-09 CYCA3;3 Cyclin A3;3 (.1) AT1G80370 45 / 9e-07 CYCA2;4 Cyclin A2;4 (.1) AT1G44110 44 / 1e-06 CYCA1;1 Cyclin A1;1 (.1) AT1G15570 42 / 1e-05 CYCA2;3 CYCLIN A2;3 (.1) AT1G77390 39 / 7e-05 TAM, DYP, CYCA1;2 TARDY ASYNCHRONOUS MEIOSIS, CYCLIN A1;2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G021100 [exp] 62 / 6e-13 AT1G47230 484 / 2e-172 CYCLIN A3;4 (.1.2) Potri.002G121500 [exp] 60 / 4e-12 AT1G47230 472 / 1e-167 CYCLIN A3;4 (.1.2) Potri.005G181400 [exp] 45 / 5e-07 AT1G44110 589 / 0.0 Cyclin A1;1 (.1) Potri.002G080000 [exp] 45 / 5e-07 AT1G44110 593 / 0.0 Cyclin A1;1 (.1) Potri.009G093100 [exp] 45 / 6e-07 AT5G43080 288 / 9e-95 Cyclin A3;1 (.1) Potri.006G247200 [exp] 41 / 2e-05 AT5G11300 494 / 3e-173 CYCLIN A2;2, mitotic-like cyclin 3B from Arabidopsis (.1) Potri.001G177100 [exp] 40 / 4e-05 AT1G80370 483 / 2e-168 Cyclin A2;4 (.1) Potri.003G058200 [exp] 39 / 8e-05 AT1G80370 494 / 9e-173 Cyclin A2;4 (.1) Potri.018G034100 [exp] 38 / 0.0002 AT5G11300 498 / 1e-174 CYCLIN A2;2, mitotic-like cyclin 3B from Arabidopsis (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024822 [exp] 53 / 2e-09 AT1G47230 452 / 5e-159 CYCLIN A3;4 (.1.2) Lus10029700 [exp] 50 / 1e-08 AT1G44110 544 / 0.0 Cyclin A1;1 (.1) Lus10042739 [exp] 42 / 1e-05 AT1G44110 508 / 1e-177 Cyclin A1;1 (.1) Lus10014199 [exp] 40 / 4e-05 AT1G44110 451 / 2e-157 Cyclin A1;1 (.1) Lus10013886 [exp] 39 / 0.0001 AT5G43080 283 / 2e-93 Cyclin A3;1 (.1) Lus10028544 [exp] 38 / 0.0004 AT1G44110 476 / 4e-167 Cyclin A1;1 (.1) Lus10008103 [exp] 37 / 0.0005 AT5G11300 465 / 6e-162 CYCLIN A2;2, mitotic-like cyclin 3B from Arabidopsis (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0065 [poplar] [flax] Cyclin PF02984 [poplar] [flax] Cyclin_C Cyclin, C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.008G008476.1 pacid=42808136 polypeptide=Potri.008G008476.1.p locus=Potri.008G008476 ID=Potri.008G008476.1.v4.1 annot-version=v4.1 ATGCACGTTCAGCCAAACTCGCAACCTTGGAGTTCTACGTTGGAGCAACGATTTCGTTATATGGCAAGTGATATGAAGGAATGTGTGAACATTTTATATG AGTTGCGTTCGGGTAAAAGACACAGAAAGCTTGAAATAAGAGAAAAATACCGGCAAGACCAGTTCTTAGGTGTGGCAAAATCTCCCCTGCCAGAACTATC TCCTTTTATTTTTTATGATTGCTTGAAGGATGCGGGGCTGTGA
AA sequence Show only first row Show all	>Potri.008G008476.1 pacid=42808136 polypeptide=Potri.008G008476.1.p locus=Potri.008G008476 ID=Potri.008G008476.1.v4.1 annot-version=v4.1 MHVQPNSQPWSSTLEQRFRYMASDMKECVNILYELRSGKRHRKLEIREKYRQDQFLGVAKSPLPELSPFIFYDCLKDAGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G43080		CYCA3;1	Cyclin A3;1 (.1)		Potri.008G008476 [exp]	0	1
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Potri.001G004700 [exp]	2.00	0.9021
AT4G35350		XCP1	xylem cysteine peptidase 1 (.1...		Potri.004G207600 [exp]	2.00	0.7959	Pt-XCP1.1
AT4G22120			ERD (early-responsive to dehyd...		Potri.011G009801 [exp]	4.58	0.7947
AT3G19940			Major facilitator superfamily ...		Potri.017G131700 [exp]	5.65	0.7284
					Potri.009G042350 [exp]	7.48	0.7373
AT1G09890			Rhamnogalacturonate lyase fami...		Potri.002G110000 [exp]	7.74	0.7954
AT3G61250	MYB	LMI2, ATMYB17	LATE MERISTEM IDENTITY2, myb d...		Potri.012G140700 [exp]	11.48	0.7953
					Potri.005G150150 [exp]	15.96	0.8699
AT4G27190			NB-ARC domain-containing disea...		Potri.001G446966 [exp]	18.00	0.7925
AT5G50570	SBP	SPL13, SPL13A	SQUAMOSA PROMOTER-BINDING PROT...		Potri.012G100700 [exp]	24.37	0.7267

Compare expression of checked genes

Potri.008G008476 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.