Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G11530 186 / 3e-56 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT4G21390 185 / 4e-55 B120 S-locus lectin protein kinase family protein (.1) AT4G03230 186 / 5e-55 S-locus lectin protein kinase family protein (.1) AT4G21380 184 / 7e-55 ARK3 receptor kinase 3 (.1) AT4G23230 179 / 2e-54 CRK15 cysteine-rich RLK (RECEPTOR-like protein kinase) 15 (.1) AT1G65800 181 / 2e-53 ARK2 receptor kinase 2 (.1) AT4G23140 179 / 2e-53 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT1G65790 179 / 6e-53 ARK1 receptor kinase 1 (.1) AT1G11340 177 / 4e-52 S-locus lectin protein kinase family protein (.1) AT4G23180 175 / 4e-52 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G023550 [exp] 215 / 5e-67 AT4G05200 541 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.011G027501 [exp] 209 / 6e-65 AT4G23180 553 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G023876 [exp] 200 / 2e-61 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.019G119851 [exp] 187 / 2e-60 AT4G03230 325 / 1e-104 S-locus lectin protein kinase family protein (.1) Potri.004G027800 [exp] 199 / 4e-60 AT4G21390 941 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G027900 [exp] 199 / 5e-60 AT4G21390 915 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G027600 [exp] 192 / 2e-59 AT4G23280 461 / 3e-156 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) Potri.013G150800 [exp] 196 / 1e-58 AT4G03230 1206 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G030650 [exp] 192 / 4e-58 AT4G05200 476 / 1e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033752 [exp] 186 / 9e-59 AT4G03230 497 / 6e-169 S-locus lectin protein kinase family protein (.1) Lus10007600 [exp] 194 / 7e-58 AT1G11300 930 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10006742 [exp] 194 / 1e-57 AT4G21390 800 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10020083 [exp] 185 / 1e-57 AT4G21390 427 / 6e-143 S-locus lectin protein kinase family protein (.1) Lus10014813 [exp] 191 / 4e-57 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018408 [exp] 190 / 1e-56 AT4G21390 936 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037731 [exp] 187 / 1e-56 AT4G27290 644 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10016871 [exp] 186 / 2e-55 AT4G27290 752 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10006745 [exp] 184 / 4e-55 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10007611 [exp] 184 / 1e-54 AT1G11340 751 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.008G009001.1 pacid=42805790 polypeptide=Potri.008G009001.1.p locus=Potri.008G009001 ID=Potri.008G009001.1.v4.1 annot-version=v4.1 ATGCCCAATGGCAGTCTTGCCCTTCACCTCCTTGGCACGGAAATGAGTGCAGAATTAGATTGGAAACTGCGGGTTAGCATTATCATCAATGGAATAGCTA GAGGCCTTGTCTATCAACACGAGGACAGTCGACTAAGAATAATTCACAGAGACATGATCAGAGCCAGCAATATTTTGTTGGATCATCAGATGAATCCAAG AGTTTCTGATTTCGGAATGGCAAGAATTTTTGGAGGAGATCAGAAGCAAGCCAATACAAATGGAGTCGCTGGTACACATGGATACATGGCGCCAGAATAT GCAATGCAAGGTATCTTCTTGGTAAAATCTTATGTTTTTGGTTTTGGAGTTCTTTTGTTAGAGATTATTGCTGGAAAAGGGAGGAATGGTGGGTTCTATC TTTCCGATGATGGTCGTCAGAGCCTACTCATGCACGCATGGAATTTATGGCATGAAGGCAAAGCAATGGAGATTATGGATTAA
AA sequence Show only first row Show all	>Potri.008G009001.1 pacid=42805790 polypeptide=Potri.008G009001.1.p locus=Potri.008G009001 ID=Potri.008G009001.1.v4.1 annot-version=v4.1 MPNGSLALHLLGTEMSAELDWKLRVSIIINGIARGLVYQHEDSRLRIIHRDMIRASNILLDHQMNPRVSDFGMARIFGGDQKQANTNGVAGTHGYMAPEY AMQGIFLVKSYVFGFGVLLLEIIAGKGRNGGFYLSDDGRQSLLMHAWNLWHEGKAMEIMD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G11530		CRK34	cysteine-rich RLK (RECEPTOR-li...		Potri.008G009001 [exp]	0	1
					Potri.014G163733 [exp]	10.24	0.9884
AT5G11390		WIT1	WPP domain-interacting protein...		Potri.004G111350 [exp]	11.48	0.9883
AT2G31690			alpha/beta-Hydrolases superfam...		Potri.014G150700 [exp]	12.36	0.9874
AT5G20940			Glycosyl hydrolase family prot...		Potri.009G154032 [exp]	12.96	0.9876
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.006G010800 [exp]	14.14	0.9859
AT4G14805			Bifunctional inhibitor/lipid-t...		Potri.010G085000 [exp]	15.87	0.9809
					Potri.010G010851 [exp]	16.00	0.9679
					Potri.013G088025 [exp]	16.43	0.9809
					Potri.005G236901 [exp]	17.54	0.9779
AT3G13430			RING/U-box superfamily protein...		Potri.017G102800 [exp]	19.44	0.9577

Compare expression of checked genes

Potri.008G009001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.