Potri.008G011620 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11591 44 / 7e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G207600 45 / 3e-08 AT3G11591 89 / 1e-25 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016986 62 / 7e-15 AT3G11591 44 / 1e-07 unknown protein
Lus10024722 39 / 9e-06 AT3G11591 74 / 1e-19 unknown protein
Lus10032336 37 / 4e-05 AT3G11591 77 / 1e-20 unknown protein
PFAM info
Representative CDS sequence
>Potri.008G011620.1 pacid=42807706 polypeptide=Potri.008G011620.1.p locus=Potri.008G011620 ID=Potri.008G011620.1.v4.1 annot-version=v4.1
ATGGGATTGTGCTTTCCTTCAACACCCAAGAAACTGGCCATGACTATAGGATTATTTGCTTCTGGAGCTGCTCTTTTTGCTCTTGGCTTGCATAAATGCT
ATGTCAACATTGCTCCTCAACGAGCTCGTATCGAAGCTCGTAATGATTTTGTCAGAGAACGATTAAGAAAGAAGTATGGCAAAGAATAG
AA sequence
>Potri.008G011620.1 pacid=42807706 polypeptide=Potri.008G011620.1.p locus=Potri.008G011620 ID=Potri.008G011620.1.v4.1 annot-version=v4.1
MGLCFPSTPKKLAMTIGLFASGAALFALGLHKCYVNIAPQRARIEARNDFVRERLRKKYGKE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G11591 unknown protein Potri.008G011620 0 1
AT5G18920 Cox19-like CHCH family protein... Potri.008G198500 2.64 0.8890
AT2G36730 Pentatricopeptide repeat (PPR)... Potri.017G083900 4.24 0.9087
AT2G36230 HISN3, APG10 ALBINO AND PALE GREEN 10, Aldo... Potri.004G090500 5.91 0.9000
AT3G08980 Peptidase S24/S26A/S26B/S26C f... Potri.016G115100 8.83 0.8750
AT5G59600 Tetratricopeptide repeat (TPR)... Potri.001G014900 10.81 0.9069
Potri.001G268000 16.24 0.8519
AT4G15720 Tetratricopeptide repeat (TPR)... Potri.008G217000 18.97 0.8331
AT1G14685 BBR_BPC BBR/BPC2, ATBPC... basic pentacysteine 2 (.1.2.3) Potri.015G032800 20.78 0.8894 GBP.2
AT3G52905 Polynucleotidyl transferase, r... Potri.001G104800 21.81 0.8493
AT3G26782 Tetratricopeptide repeat (TPR)... Potri.001G322100 22.91 0.8720

Potri.008G011620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.