Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64620 67 / 7e-14 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT3G17220 56 / 8e-10 ATPMEI2 pectin methylesterase inhibitor 2 (.1) AT5G24370 51 / 3e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 50 / 1e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G05741 41 / 0.0002 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17130 39 / 0.0005 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G001600 [exp] 159 / 6e-50 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.006G134900 [exp] 68 / 2e-14 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.005G007100 [exp] 67 / 6e-14 AT1G09360 85 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.004G016500 [exp] 64 / 6e-13 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 62 / 5e-12 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.008G102600 [exp] 49 / 2e-07 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023100 [exp] 47 / 2e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023201 [exp] 47 / 2e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G023050 [exp] 47 / 3e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038738 [exp] 157 / 4e-49 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10039120 [exp] 150 / 3e-46 AT5G64620 69 / 5e-15 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10038737 [exp] 55 / 1e-09 AT5G64620 56 / 7e-10 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10022409 [exp] 52 / 3e-08 AT5G64620 155 / 3e-48 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Lus10037791 [exp] 49 / 3e-07 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017077 [exp] 46 / 2e-06 AT3G17152 76 / 1e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017345 [exp] 46 / 3e-06 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1) Lus10027947 [exp] 45 / 5e-06 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 44 / 1e-05 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037793 [exp] 44 / 3e-05 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.008G013400.1 pacid=42806266 polypeptide=Potri.008G013400.1.p locus=Potri.008G013400 ID=Potri.008G013400.1.v4.1 annot-version=v4.1 ATGACTAGATATCATTCCTTCTCTGTCCCCTATCACTTTCTTGCTTTCTTGGTTTGTTTCATCCTCGTCCATGCTTCCCCAGCAGCCGCTGATAAGCCAA CCGAGCTAGTAGACAAGGTCTGCAACCAAACATCAAACTACACTCTCTGTGTCGAAGCTCTTTATTCCGACTCACGTACCCCAGATGCCGATAGCTACAC ACTGGCCTTCATCTCCTTTGGATTAGCATACACCAATGCAAACAACATCAGAGACTACTACATAGCAGAGCTACTCAAGAATACTTCTAGTCAAGATTAC CATTACCGTCTCGAAACATGCAGCCATGATTATCTCAGGGCGGTTTCTAAACTAGAAGAGGCCTACAATGACTTGAACTCGGAGACCTTTTTTGGGTTGG CTGAGTTGGCAGGTATTGCTTCTGAAGCTTCTGATCATTGCCAGGATGCTTTCAAGGGAATCTCTTCACCACCTTTAGGGAGCAGGAATGGTGATTTAAA ACGTCTTTGTGAAATCGGTGCCATCATTGCTAAGTTGTTTACTGGATCCTCGTGA
AA sequence Show only first row Show all	>Potri.008G013400.1 pacid=42806266 polypeptide=Potri.008G013400.1.p locus=Potri.008G013400 ID=Potri.008G013400.1.v4.1 annot-version=v4.1 MTRYHSFSVPYHFLAFLVCFILVHASPAAADKPTELVDKVCNQTSNYTLCVEALYSDSRTPDADSYTLAFISFGLAYTNANNIRDYYIAELLKNTSSQDY HYRLETCSHDYLRAVSKLEEAYNDLNSETFFGLAELAGIASEASDHCQDAFKGISSPPLGSRNGDLKRLCEIGAIIAKLFTGSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Potri.008G013400 [exp]	0	1
AT3G18260			Reticulon family protein (.1)		Potri.015G044300 [exp]	1.00	0.9613
AT1G76040		CPK29	calcium-dependent protein kina...		Potri.002G017000 [exp]	5.65	0.9426
AT5G03795			Exostosin family protein (.1)		Potri.014G171100 [exp]	6.32	0.9182
AT3G27027			Protein of unknown function (D...		Potri.017G064972 [exp]	6.32	0.9315
AT5G42570			B-cell receptor-associated 31-...		Potri.011G089100 [exp]	9.59	0.9319
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Potri.003G040700 [exp]	10.09	0.8967
AT1G54400			HSP20-like chaperones superfam...		Potri.013G054900 [exp]	13.19	0.8345
AT3G26935			DHHC-type zinc finger family p...		Potri.001G070100 [exp]	13.71	0.8630
AT1G60360			RING/U-box superfamily protein...		Potri.002G085800 [exp]	14.96	0.8785
AT5G20870			O-Glycosyl hydrolases family 1...		Potri.006G216700 [exp]	18.16	0.9256

Compare expression of checked genes

Potri.008G013400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.