Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20045 56 / 4e-12 unknown protein AT2G35658 55 / 2e-11 unknown protein AT5G61630 51 / 2e-09 unknown protein AT5G07490 50 / 3e-09 unknown protein AT4G16840 36 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G015100 [exp] 157 / 5e-52 AT5G20045 52 / 3e-10 unknown protein Potri.003G081900 [exp] 57 / 2e-12 AT2G35658 84 / 3e-23 unknown protein Potri.001G152700 [exp] 56 / 6e-12 AT2G35658 81 / 1e-21 unknown protein Potri.001G080500 [exp] 56 / 4e-11 AT5G61630 155 / 2e-49 unknown protein Potri.009G093700 [exp] 38 / 0.0002 AT1G07860 67 / 7e-14 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042998 [exp] 64 / 3e-14 AT5G07490 117 / 2e-34 unknown protein Lus10032501 [exp] 64 / 3e-14 AT5G61630 129 / 2e-39 unknown protein Lus10019440 [exp] 62 / 3e-14 AT5G20045 63 / 9e-15 unknown protein Lus10000594 [exp] 49 / 7e-09 AT2G35658 79 / 1e-20 unknown protein Lus10011000 [exp] 48 / 2e-08 AT2G35658 74 / 5e-18 unknown protein Lus10043296 [exp] 42 / 7e-06 AT1G68680 83 / 2e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G015800.1 pacid=42808001 polypeptide=Potri.008G015800.1.p locus=Potri.008G015800 ID=Potri.008G015800.1.v4.1 annot-version=v4.1 ATGCATAGGTCAGCGAGTGGAACTCGGGCCTCTGATGAGTTCTTGATCAGCCTGGCACCAGCTGCCGATGTATCCCCTCTGAAAAATACAGCTTACTCAG AGTTACCAACCCATGATCCCATATCTGATGTGACCAAGAAGGATCTTGCTTGGCATCACAAGTCCATGGGAGAAAATGCCGTTCACCTCATCCCGGTAGT CCTGATTCTATGTGCTTTGACTCTCTGGATTTTTTCTTATCCGTATAAACTGTAA
AA sequence Show only first row Show all	>Potri.008G015800.1 pacid=42808001 polypeptide=Potri.008G015800.1.p locus=Potri.008G015800 ID=Potri.008G015800.1.v4.1 annot-version=v4.1 MHRSASGTRASDEFLISLAPAADVSPLKNTAYSELPTHDPISDVTKKDLAWHHKSMGENAVHLIPVVLILCALTLWIFSYPYKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20045			unknown protein		Potri.008G015800 [exp]	0	1
AT5G49630		AAP6	amino acid permease 6 (.1)		Potri.006G236100 [exp]	14.49	0.8268
AT3G19920			unknown protein		Potri.007G073600 [exp]	15.65	0.8268
					Potri.008G063301 [exp]	18.65	0.6808
					Potri.008G053150 [exp]	19.62	0.8268
AT1G06137			unknown protein		Potri.001G380300 [exp]	22.18	0.6182
					Potri.006G017750 [exp]	29.93	0.8169
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.011G026100 [exp]	39.03	0.8248
AT1G20180			Protein of unknown function (D...		Potri.002G067300 [exp]	39.98	0.7359
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.011G025966 [exp]	40.47	0.8235
AT3G51020			unknown protein		Potri.002G011500 [exp]	41.95	0.7284

Compare expression of checked genes

Potri.008G015800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.