Potri.008G016150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07610 42 / 7e-05 F-box family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G016300 218 / 2e-73 AT5G07610 53 / 2e-08 F-box family protein (.1)
Potri.013G109900 67 / 2e-13 AT5G07610 61 / 7e-10 F-box family protein (.1)
Potri.013G110300 66 / 2e-13 AT5G07610 54 / 7e-08 F-box family protein (.1)
Potri.013G109701 53 / 9e-09 ND /
Potri.010G254000 48 / 5e-07 AT5G07610 149 / 1e-40 F-box family protein (.1)
Potri.013G065500 39 / 0.0008 AT5G07610 155 / 6e-43 F-box family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042989 46 / 2e-06 AT5G07610 82 / 9e-19 F-box family protein (.1)
PFAM info
Representative CDS sequence
>Potri.008G016150.1 pacid=42808485 polypeptide=Potri.008G016150.1.p locus=Potri.008G016150 ID=Potri.008G016150.1.v4.1 annot-version=v4.1
ATGCTTAAAAGTGTTTGCAAATGTTGGAACAATCTGATTACTGATGCTTGTGTTCCAAAAATCTCAGACTCTTCACCTCTTCGTGGCTTTATTTACCATG
CGTTGAGGGTCAGAAGCGGGAAAACATACATTGATTATATCCCCTGCGCCATGACTCCAGCAGTTGCACCGGAACCACATGAATTTGTCAAGTCCTATTC
TTCGTTGTTGCCTTTTGAACCTGCCCGGGGTGATTTCCTTGATTGTTGCAATTGTTTGCTTTTGTTTGTTGAGGGTTCTATTTCACAGTACTATGTTTGC
AATCCTGTGACAAAACAGTGTGTGGCGATTCCTAGAGATTTTATGCTCGAAAACATATGTTCTGCAGCCCTGGCATTTGATCCTTTCAAATCACCTCACT
ACAAAGTTGTTTGCTTTGATTATTCAGAGCCCAAGCCCCCCCCAAAGATTGCGCGTGTTCTCATCAGAGACTAG
AA sequence
>Potri.008G016150.1 pacid=42808485 polypeptide=Potri.008G016150.1.p locus=Potri.008G016150 ID=Potri.008G016150.1.v4.1 annot-version=v4.1
MLKSVCKCWNNLITDACVPKISDSSPLRGFIYHALRVRSGKTYIDYIPCAMTPAVAPEPHEFVKSYSSLLPFEPARGDFLDCCNCLLLFVEGSISQYYVC
NPVTKQCVAIPRDFMLENICSAALAFDPFKSPHYKVVCFDYSEPKPPPKIARVLIRD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07610 F-box family protein (.1) Potri.008G016150 0 1
Potri.003G027318 2.00 0.9096
AT2G20280 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Potri.016G084100 2.64 0.8718
Potri.003G027116 2.82 0.9092
AT4G24290 MAC/Perforin domain-containing... Potri.003G006500 3.00 0.8568
Potri.001G298266 4.24 0.8893
AT1G31240 Bromodomain transcription fact... Potri.015G118200 6.16 0.8063
Potri.001G298233 6.32 0.8763
AT4G21090 ATMFDX2 ARABIDOPSIS MITOCHONDRIAL FER... Potri.001G044700 6.92 0.8241
AT2G37840 Protein kinase superfamily pro... Potri.006G092900 7.74 0.8145
AT4G27510 unknown protein Potri.004G133900 8.83 0.8223

Potri.008G016150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.