Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07610 54 / 1e-08 F-box family protein (.1) AT3G25460 50 / 2e-07 F-box and associated interaction domains-containing protein (.1) AT3G44130 44 / 3e-05 F-box and associated interaction domains-containing protein (.1) AT3G18340 43 / 4e-05 F-box and associated interaction domains-containing protein (.1) AT3G21170 43 / 5e-05 F-box and associated interaction domains-containing protein (.1) AT3G13820 42 / 0.0002 F-box and associated interaction domains-containing protein (.1) AT3G52320 41 / 0.0003 F-box and associated interaction domains-containing protein (.1) AT5G47300 40 / 0.0004 F-box and associated interaction domains-containing protein (.1) AT2G16810 40 / 0.0004 F-box and associated interaction domains-containing protein (.1) AT3G10240 40 / 0.0005 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G016150 [exp] 244 / 8e-84 AT5G07610 42 / 9e-05 F-box family protein (.1) Potri.013G109900 [exp] 112 / 9e-30 AT5G07610 61 / 7e-10 F-box family protein (.1) Potri.013G110300 [exp] 112 / 1e-29 AT5G07610 54 / 7e-08 F-box family protein (.1) Potri.013G109701 [exp] 75 / 3e-16 ND / Potri.010G254000 [exp] 66 / 8e-13 AT5G07610 149 / 1e-40 F-box family protein (.1) Potri.017G102300 [exp] 52 / 6e-08 AT5G15710 744 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1) Potri.013G067800 [exp] 48 / 9e-07 AT5G07610 131 / 4e-34 F-box family protein (.1) Potri.004G112400 [exp] 48 / 1e-06 AT5G15710 753 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1) Potri.005G043500 [exp] 43 / 5e-05 AT5G07610 135 / 7e-36 F-box family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031955 [exp] 47 / 2e-06 AT5G15710 719 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1) Lus10013987 [exp] 47 / 4e-06 AT3G23950 59 / 1e-08 F-box family protein (.1) Lus10035147 [exp] 45 / 1e-05 AT5G15710 721 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1) Lus10042989 [exp] 44 / 2e-05 AT5G07610 82 / 9e-19 F-box family protein (.1) Lus10040838 [exp] 44 / 6e-05 AT3G23950 57 / 2e-08 F-box family protein (.1) Lus10016522 [exp] 43 / 6e-05 AT2G37890 155 / 6e-42 Mitochondrial substrate carrier family protein (.1) Lus10002769 [exp] 43 / 7e-05 AT1G15680 64 / 2e-11 F-box family protein (.1) Lus10008162 [exp] 41 / 0.0001 AT1G60370 48 / 5e-07 F-box and associated interaction domains-containing protein (.1) Lus10040800 [exp] 42 / 0.0002 AT3G21120 84 / 8e-18 F-box and associated interaction domains-containing protein (.1) Lus10007302 [exp] 42 / 0.0002 AT1G15680 49 / 4e-06 F-box family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [poplar] [flax] F-box PF00646 [poplar] [flax] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Potri.008G016300.1 pacid=42805722 polypeptide=Potri.008G016300.1.p locus=Potri.008G016300 ID=Potri.008G016300.1.v4.1 annot-version=v4.1 ATGGCTGCTTCTTTAGATGGAAAAGCAAGTAAGAGCAAGAACTGCAGCTGTGCTAGTTTTCTTTGTTCGAGTTTACCAGATGATGTGCTGGTTGAAATCC TCTGTCGAGTTACTGATCGCAAGCATCTCATTAGACTCAAAAGTGTTTGCAAATCTTGGAACAATCTGATTACTGATGCTTGTGTTCCGAAAATCTCAGC TTCCTCACCTCTTCATGGCTTTATTTACCTTGCGAAGAAGATCGGATTTGGCAAACCATACATTGATTATATCCCTTGCGCCATTACTCCAGCAGTTGCA CCAGAACCACATGAATTTGTCAAGTCCTATTCTTCGCTGTTGCCTTTTGAACCTGCCCGGGGTGATTTCCTTGATTGTTGCAACGGTTTGCTTTTGTTTG TTGAGGGTTGCACTCTGCAGTACTATGTATGCAATCCCGCGACAAAACACTGTGTAGCGATTCCTAGAGATTTTATGCTCGAGAACATAATTTTTGCGGC CCTGGCTTTTGATCCTTCCACATCACCTCACTACAGAGTTGTTTGCTTTGATTATTCAGAGTCTAGCCCCCTGTAA
AA sequence Show only first row Show all	>Potri.008G016300.1 pacid=42805722 polypeptide=Potri.008G016300.1.p locus=Potri.008G016300 ID=Potri.008G016300.1.v4.1 annot-version=v4.1 MAASLDGKASKSKNCSCASFLCSSLPDDVLVEILCRVTDRKHLIRLKSVCKSWNNLITDACVPKISASSPLHGFIYLAKKIGFGKPYIDYIPCAITPAVA PEPHEFVKSYSSLLPFEPARGDFLDCCNGLLLFVEGCTLQYYVCNPATKHCVAIPRDFMLENIIFAALAFDPSTSPHYRVVCFDYSESSPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G07610			F-box family protein (.1)		Potri.008G016300 [exp]	0	1
AT3G16090		AtHrd1A	homolog of yeast Hrd1, RING/U-...		Potri.013G088400 [exp]	1.41	0.9243
					Potri.001G298266 [exp]	5.00	0.8918
AT1G75340	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.006G081100 [exp]	5.19	0.8459
					Potri.001G298233 [exp]	5.47	0.8900
AT5G04260		WCRKC2	WCRKC thioredoxin 2 (.1)		Potri.010G225701 [exp]	5.47	0.8738
AT1G10130		ATECA3, ECA3	ARABIDOPSIS THALIANA ER-TYPE C...		Potri.002G117400 [exp]	6.24	0.8754
					Potri.003G027318 [exp]	6.32	0.8879
AT1G29370			Kinase-related protein of unkn...		Potri.005G202851 [exp]	6.32	0.8818
AT4G27510			unknown protein		Potri.004G133900 [exp]	7.74	0.8431
					Potri.003G027116 [exp]	7.74	0.8771

Compare expression of checked genes

Potri.008G016300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.