Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18980 122 / 7e-35 RmlC-like cupins superfamily protein (.1) AT5G38910 122 / 8e-35 RmlC-like cupins superfamily protein (.1) AT4G14630 122 / 8e-35 GLP9 germin-like protein 9 (.1) AT1G18970 122 / 1e-34 GLP4 germin-like protein 4 (.1) AT5G38930 121 / 2e-34 RmlC-like cupins superfamily protein (.1) AT1G02335 120 / 3e-34 GL22 germin-like protein subfamily 2 member 2 precursor (.1) AT1G09560 119 / 1e-33 GLP5 germin-like protein 5 (.1) AT5G38960 118 / 4e-33 RmlC-like cupins superfamily protein (.1) AT3G04200 117 / 1e-32 RmlC-like cupins superfamily protein (.1) AT5G38940 115 / 4e-32 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G240500 [exp] 333 / 6e-118 AT3G04200 123 / 5e-35 RmlC-like cupins superfamily protein (.1) Potri.010G240700 [exp] 255 / 4e-87 AT1G02335 141 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1) Potri.009G157100 [exp] 253 / 2e-86 AT1G09560 105 / 3e-28 germin-like protein 5 (.1) Potri.010G240600 [exp] 251 / 1e-85 AT3G62020 112 / 3e-31 germin-like protein 10 (.1.2) Potri.004G194600 [exp] 246 / 1e-83 AT3G62020 129 / 4e-37 germin-like protein 10 (.1.2) Potri.008G084300 [exp] 246 / 1e-83 AT1G02335 147 / 3e-44 germin-like protein subfamily 2 member 2 precursor (.1) Potri.013G116500 [exp] 177 / 2e-56 AT1G18970 70 / 1e-14 germin-like protein 4 (.1) Potri.013G000500 [exp] 134 / 1e-39 AT1G09560 311 / 1e-108 germin-like protein 5 (.1) Potri.005G001300 [exp] 130 / 1e-37 AT3G62020 309 / 5e-108 germin-like protein 10 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020631 [exp] 241 / 7e-82 AT3G10080 132 / 7e-39 RmlC-like cupins superfamily protein (.1) Lus10004857 [exp] 238 / 2e-80 AT1G02335 140 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1) Lus10004854 [exp] 237 / 6e-80 AT1G02335 137 / 2e-40 germin-like protein subfamily 2 member 2 precursor (.1) Lus10004855 [exp] 237 / 8e-80 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1) Lus10004856 [exp] 232 / 7e-78 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1) Lus10020632 [exp] 225 / 1e-75 AT1G02335 129 / 1e-37 germin-like protein subfamily 2 member 2 precursor (.1) Lus10034191 [exp] 207 / 3e-68 AT1G18970 136 / 4e-40 germin-like protein 4 (.1) Lus10004858 [exp] 197 / 3e-64 AT1G02335 123 / 7e-35 germin-like protein subfamily 2 member 2 precursor (.1) Lus10043393 [exp] 188 / 8e-61 AT1G18970 123 / 3e-35 germin-like protein 4 (.1) Lus10038014 [exp] 127 / 1e-36 AT3G62020 327 / 5e-115 germin-like protein 10 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.008G016700.2 pacid=42805877 polypeptide=Potri.008G016700.2.p locus=Potri.008G016700 ID=Potri.008G016700.2.v4.1 annot-version=v4.1 ATGAAAAGTAACATAGAAATTTCAGCACTTTCTAGCAAGCAGGAGACTGCCTTAGCAAGTGATCCTGATATACTTTCGGATTTCATTGCACCAACTAACA CAAGTGTTGATGGAAAGTTCTTCACTTTCACAGGAATGCGTGGGGTTATTACAAAATTTCCTCAAAACTTCACTTTAACAAAAGCTACCATGAACGAGTT CCCAGCTCTCAACGGGCAGAGTGTGTCATATGCTGTGCTTCAATACCCTGCCGATGGTCTGAACCCACCTCACACCCACCCTCGCGCTGCTGAACTCTTG TTCCTTGTGTATGGTAGCCTTGAAGTTGGATTTGTTGACACCAAAAATGTGCTTTACACCCAGAGCCTCCAAGTTGGAGATATGTTTATTTTTCCAAAGG GTCTTGTGCACCATCAATACAACCCAACCCAAAAATCAGCAATTGCGATTTCTTCTTTTGGTAGCGCAAATGCTGGAACAGTTTCTGTGCCTTTGTCTGT CTTTGCAACAGGAATCGATGATGGTATTCTTGCCAAGGCATTCAAGACTGATGTATCTACCATTCAGAAGATCAAGTCTGGCTTTAGCAAGCCCTAA
AA sequence Show only first row Show all	>Potri.008G016700.2 pacid=42805877 polypeptide=Potri.008G016700.2.p locus=Potri.008G016700 ID=Potri.008G016700.2.v4.1 annot-version=v4.1 MKSNIEISALSSKQETALASDPDILSDFIAPTNTSVDGKFFTFTGMRGVITKFPQNFTLTKATMNEFPALNGQSVSYAVLQYPADGLNPPHTHPRAAELL FLVYGSLEVGFVDTKNVLYTQSLQVGDMFIFPKGLVHHQYNPTQKSAIAISSFGSANAGTVSVPLSVFATGIDDGILAKAFKTDVSTIQKIKSGFSKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G18980			RmlC-like cupins superfamily p...		Potri.008G016700 [exp]	0	1
AT5G43360		PHT1;3, ATPT4, ...	PHOSPHATE TRANSPORTER 3, phosp...		Potri.019G061900 [exp]	12.56	0.9402	8,Pt-PT2.6
AT1G09910			Rhamnogalacturonate lyase fami...		Potri.011G006200 [exp]	18.54	0.9396
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.009G143600 [exp]	21.35	0.9373
AT5G59100			Subtilisin-like serine endopep...		Potri.010G196800 [exp]	25.76	0.9361
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Potri.003G118500 [exp]	28.28	0.9354
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.007G075300 [exp]	30.98	0.9353
AT1G16060	AP2_ERF	ADAP	ARIA-interacting double AP2 do...		Potri.006G179900 [exp]	34.69	0.9343
AT5G45890		SAG12	senescence-associated gene 12 ...		Potri.005G088600 [exp]	37.52	0.9343
AT5G67360		ARA12	Subtilase family protein (.1)		Potri.014G026600 [exp]	39.79	0.9343
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Potri.004G191500 [exp]	43.87	0.9342

Compare expression of checked genes

Potri.008G016700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.