Potri.008G017701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04830 134 / 3e-41 Nuclear transport factor 2 (NTF2) family protein (.1), Nuclear transport factor 2 (NTF2) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G241700 143 / 2e-44 AT5G04830 264 / 3e-91 Nuclear transport factor 2 (NTF2) family protein (.1), Nuclear transport factor 2 (NTF2) family protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008971 112 / 5e-32 AT5G04830 230 / 2e-77 Nuclear transport factor 2 (NTF2) family protein (.1), Nuclear transport factor 2 (NTF2) family protein (.2)
Lus10028847 108 / 5e-30 AT5G04830 202 / 7e-66 Nuclear transport factor 2 (NTF2) family protein (.1), Nuclear transport factor 2 (NTF2) family protein (.2)
PFAM info
Representative CDS sequence
>Potri.008G017701.1 pacid=42806297 polypeptide=Potri.008G017701.1.p locus=Potri.008G017701 ID=Potri.008G017701.1.v4.1 annot-version=v4.1
ATGAATGCCTTTGCATTGTCTTCTTCTGCTGATTTTATGATTCCACAGGGTGAAGCAGATCAAATCAGCTTTCTATTCAATTTGCTTTACATGATACATT
TGCTTCAGATATTAATTGACAGCAAACAGCACTATAAGTTCCTTGGAAGAAATATAGATTTGATATCACTCATTAAGCTATACATCGAGGATGGGAAGGT
AGTTCGCCATGAAGATTGGTGGTACAAGAAGCCAATTGGAAACAGAGAAACAAACAGGTTTCCTCTGGTTGGCCACTTAATGGAAACACTTCGCCGAGGA
TCAATGCTTGCAGCTCATTCTTTGATGGGATTCGGAAAGGACCCCTCCACGTAA
AA sequence
>Potri.008G017701.1 pacid=42806297 polypeptide=Potri.008G017701.1.p locus=Potri.008G017701 ID=Potri.008G017701.1.v4.1 annot-version=v4.1
MNAFALSSSADFMIPQGEADQISFLFNLLYMIHLLQILIDSKQHYKFLGRNIDLISLIKLYIEDGKVVRHEDWWYKKPIGNRETNRFPLVGHLMETLRRG
SMLAAHSLMGFGKDPST

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G04830 Nuclear transport factor 2 (NT... Potri.008G017701 0 1
AT3G01060 unknown protein Potri.004G125301 2.44 0.7551
AT4G02570 AXR6, ATCUL1 AUXIN RESISTANT 6, cullin 1 (.... Potri.013G020000 8.48 0.7219
Potri.017G120700 9.21 0.7584
AT3G54940 Papain family cysteine proteas... Potri.010G228400 27.05 0.7245
AT3G53400 unknown protein Potri.016G088900 28.16 0.6327
AT5G19290 alpha/beta-Hydrolases superfam... Potri.010G222300 55.49 0.6702
Potri.008G206100 116.21 0.6251
Potri.006G250500 116.75 0.6306
AT3G07720 Galactose oxidase/kelch repeat... Potri.014G168300 117.38 0.6433
AT1G15215 SHH1, DTF1 SAWADEE homeodomain homolog 1,... Potri.001G189200 117.96 0.5651

Potri.008G017701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.