Potri.008G019000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06490 132 / 5e-39 RING/U-box superfamily protein (.1)
AT2G35910 116 / 1e-32 RING/U-box superfamily protein (.1)
AT2G46160 95 / 2e-24 RING/U-box superfamily protein (.1)
AT3G61550 94 / 4e-24 RING/U-box superfamily protein (.1)
AT5G07040 89 / 1e-22 RING/U-box superfamily protein (.1)
AT5G53110 90 / 2e-21 RING/U-box superfamily protein (.1)
AT2G25409 86 / 2e-21 unknown protein
AT2G46495 89 / 4e-21 RING/U-box superfamily protein (.1)
AT2G25410 85 / 9e-20 RING/U-box superfamily protein (.1)
AT2G34990 84 / 1e-19 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G243200 285 / 9e-100 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1)
Potri.010G243500 207 / 2e-69 AT5G06490 113 / 6e-32 RING/U-box superfamily protein (.1)
Potri.010G243400 158 / 1e-49 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1)
Potri.016G067900 144 / 5e-44 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1)
Potri.006G201500 133 / 7e-40 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1)
Potri.008G018900 130 / 4e-39 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1)
Potri.010G243300 126 / 2e-37 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1)
Potri.002G165200 106 / 6e-29 AT3G61550 204 / 5e-67 RING/U-box superfamily protein (.1)
Potri.014G091000 100 / 1e-26 AT3G61550 176 / 1e-55 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041079 102 / 3e-27 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1)
Lus10003400 94 / 2e-24 AT5G53110 152 / 3e-45 RING/U-box superfamily protein (.1)
Lus10024124 89 / 2e-22 AT5G07040 190 / 2e-62 RING/U-box superfamily protein (.1)
Lus10032382 92 / 5e-22 AT5G53110 237 / 1e-74 RING/U-box superfamily protein (.1)
Lus10023086 91 / 9e-22 AT5G53110 161 / 1e-59 RING/U-box superfamily protein (.1)
Lus10036404 86 / 1e-21 AT3G61550 149 / 2e-46 RING/U-box superfamily protein (.1)
Lus10012628 90 / 3e-21 AT5G53110 284 / 5e-93 RING/U-box superfamily protein (.1)
Lus10019018 88 / 8e-21 AT5G53110 332 / 4e-112 RING/U-box superfamily protein (.1)
Lus10005389 84 / 8e-21 AT5G07040 154 / 9e-49 RING/U-box superfamily protein (.1)
Lus10031515 87 / 2e-20 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.008G019000.2 pacid=42807335 polypeptide=Potri.008G019000.2.p locus=Potri.008G019000 ID=Potri.008G019000.2.v4.1 annot-version=v4.1
ATGAATAGCAGTAGTCCTGTAGAAACTCGTACACAAACTTTTGGTGAGTGTGCCCTCACTTTTGGGATACCAATTGGCGTGTTTTCAGTAATTGCAATTG
CTATTCTTGCTTCCTATTTCTGCTCCAGGAAGCCAATACCTGCAGGCCATTCTCTTCATGATGTCTCCTTGTCCATAAATGGTCAAGACTCGGTCATTAT
AGAAATAGGTCTGAACGAAGCCACTCTCAATACCTATCCAAAGCTTCTTTATTCTGAAGCAAAGGAAAAGCTTGAAAAGGGTGATGATTTGGCAGCTACT
TCATGTTGCTCAATTTGCTTGCAAGACTATAAAGATAGTGACCTGCTACGGCTGTTACCTGAGTGTGGTCATCTTTTCCATGCACAGTGCATTGATCTAT
GGTTGAAGTTGCATCCTACCTGTCCAATATGTCGAAACTCGCCTGTCCCAACGCCAATCAATGTCACCGAAACAGCTTCCAGGGCACCCCGGAGAGTGTT
GTATGATGCATTTTTTGTACAGTTAATGCACTAG
AA sequence
>Potri.008G019000.2 pacid=42807335 polypeptide=Potri.008G019000.2.p locus=Potri.008G019000 ID=Potri.008G019000.2.v4.1 annot-version=v4.1
MNSSSPVETRTQTFGECALTFGIPIGVFSVIAIAILASYFCSRKPIPAGHSLHDVSLSINGQDSVIIEIGLNEATLNTYPKLLYSEAKEKLEKGDDLAAT
SCCSICLQDYKDSDLLRLLPECGHLFHAQCIDLWLKLHPTCPICRNSPVPTPINVTETASRAPRRVLYDAFFVQLMH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G06490 RING/U-box superfamily protein... Potri.008G019000 0 1
AT2G45510 CYP704A2 "cytochrome P450, family 704, ... Potri.014G072000 10.81 0.9049 Pt-CYP704.1
AT5G20700 Protein of unknown function (D... Potri.006G139200 12.44 0.9039
AT5G53160 RCAR3, PYL8 PYR1-like 8, regulatory compon... Potri.015G020500 12.96 0.8999
AT1G68540 TKPR2, CCRL6 tetraketide alpha-pyrone reduc... Potri.008G120200 14.83 0.8963
AT1G69310 WRKY ATWRKY57, WRKY5... WRKY DNA-binding protein 57 (.... Potri.008G094000 16.43 0.8995
AT1G69310 WRKY ATWRKY57, WRKY5... WRKY DNA-binding protein 57 (.... Potri.010G160100 25.82 0.8926
AT5G20230 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14,... Potri.006G067400 32.61 0.9014
AT5G65250 unknown protein Potri.005G073500 32.72 0.8988
AT5G52010 C2H2ZnF C2H2-like zinc finger protein ... Potri.014G025100 33.76 0.9040
AT1G55000 peptidoglycan-binding LysM dom... Potri.005G032100 34.40 0.8905

Potri.008G019000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.