Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34555 132 / 2e-41 Ribosomal protein S25 family protein (.1) AT4G39200 132 / 2e-41 Ribosomal protein S25 family protein (.1.2) AT2G21580 131 / 4e-41 Ribosomal protein S25 family protein (.1.2) AT2G16360 127 / 2e-39 Ribosomal protein S25 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G239300 [exp] 147 / 2e-47 AT4G39200 131 / 6e-41 Ribosomal protein S25 family protein (.1.2) Potri.004G157200 [exp] 142 / 1e-45 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) Potri.009G118900 [exp] 142 / 1e-45 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034277 [exp] 137 / 3e-43 AT2G21580 157 / 3e-51 Ribosomal protein S25 family protein (.1.2) Lus10021706 [exp] 134 / 6e-42 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10035060 [exp] 134 / 6e-42 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10023552 [exp] 130 / 2e-40 AT4G39200 169 / 7e-56 Ribosomal protein S25 family protein (.1.2) Lus10040436 [exp] 122 / 6e-38 AT4G39200 130 / 3e-41 Ribosomal protein S25 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF03297 [poplar] [flax] Ribosomal_S25 S25 ribosomal protein
Representative CDS sequence Show only first row Show all	>Potri.008G020000.1 pacid=42808268 polypeptide=Potri.008G020000.1.p locus=Potri.008G020000 ID=Potri.008G020000.1.v4.1 annot-version=v4.1 ATGGCACCAAAGAAGGAGAAGGCTCCACCACCGTCTTCAAAACCAGCTAAGTCTGGCGGTGGCAAACAGAAGAAGAAGAAATGGAGCAAGGGAAAGCAAA AGGAGAAGGTGAACAACATGGTTTTGTTTGATCAAGCTACCTACGATAAGCTTCTTTCTGAAGCTCCCAAGTACAAGCTTATAACTCCTTCTGTCTTGTC TGACAGATTGAGGATTAGTGGCTCTCTTGCACGCAAAGCAATCAAGGATCTAATGGCCAGAGGATCCATTAGGATGGTATCTGCACATGCCAGCCAACAG ATCTACACCAGGGCTACCAACACCTAA
AA sequence Show only first row Show all	>Potri.008G020000.1 pacid=42808268 polypeptide=Potri.008G020000.1.p locus=Potri.008G020000 ID=Potri.008G020000.1.v4.1 annot-version=v4.1 MAPKKEKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLSEAPKYKLITPSVLSDRLRISGSLARKAIKDLMARGSIRMVSAHASQQ IYTRATNT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G34555			Ribosomal protein S25 family p...		Potri.008G020000 [exp]	0	1
AT4G34670			Ribosomal protein S3Ae (.1)		Potri.005G051200 [exp]	1.00	0.9636
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Potri.007G096300 [exp]	3.87	0.9496
AT1G43170		RPL3A, ARP1, EM...	embryo defective 2207, ribosom...		Potri.005G194500 [exp]	5.47	0.9635	ARP1.1
AT1G74050			Ribosomal protein L6 family pr...		Potri.001G271500 [exp]	9.00	0.9457
AT4G27090			Ribosomal protein L14 (.1)		Potri.008G168600 [exp]	9.53	0.9485
AT5G28060			Ribosomal protein S24e family ...		Potri.008G152500 [exp]	10.00	0.9497
AT4G14320			Zinc-binding ribosomal protein...		Potri.005G092500 [exp]	10.09	0.9552
AT4G39200			Ribosomal protein S25 family p...		Potri.010G239300 [exp]	10.95	0.9201
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.013G106800 [exp]	15.00	0.9392	Pt-RPL15.2
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.001G156100 [exp]	15.09	0.9487	RPL15.3

Compare expression of checked genes

Potri.008G020000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.