Potri.008G020800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10080 263 / 6e-90 RmlC-like cupins superfamily protein (.1)
AT1G02335 169 / 7e-53 GL22 germin-like protein subfamily 2 member 2 precursor (.1)
AT3G62020 161 / 7e-50 GLP10 germin-like protein 10 (.1.2)
AT3G04200 158 / 2e-48 RmlC-like cupins superfamily protein (.1)
AT1G18980 157 / 4e-48 RmlC-like cupins superfamily protein (.1)
AT1G18970 155 / 2e-47 GLP4 germin-like protein 4 (.1)
AT5G26700 154 / 4e-47 RmlC-like cupins superfamily protein (.1)
AT5G38960 154 / 6e-47 RmlC-like cupins superfamily protein (.1)
AT1G09560 154 / 8e-47 GLP5 germin-like protein 5 (.1)
AT5G38910 153 / 2e-46 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G238200 383 / 1e-137 AT3G10080 263 / 7e-90 RmlC-like cupins superfamily protein (.1)
Potri.010G238100 273 / 7e-94 AT3G10080 197 / 6e-64 RmlC-like cupins superfamily protein (.1)
Potri.014G110400 169 / 1e-52 AT3G62020 328 / 2e-115 germin-like protein 10 (.1.2)
Potri.002G184900 167 / 3e-52 AT3G62020 332 / 3e-117 germin-like protein 10 (.1.2)
Potri.009G140400 160 / 3e-49 AT5G39110 247 / 3e-83 RmlC-like cupins superfamily protein (.1)
Potri.009G140350 159 / 6e-49 AT5G39110 249 / 3e-84 RmlC-like cupins superfamily protein (.1)
Potri.013G052000 155 / 1e-47 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
Potri.019G026500 155 / 2e-47 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Potri.019G026400 155 / 2e-47 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014192 255 / 2e-86 AT3G10080 272 / 7e-93 RmlC-like cupins superfamily protein (.1)
Lus10022721 211 / 7e-70 ND 210 / 2e-69
Lus10038014 168 / 2e-52 AT3G62020 327 / 5e-115 germin-like protein 10 (.1.2)
Lus10026962 161 / 8e-50 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1)
Lus10035278 160 / 2e-49 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1)
Lus10030048 160 / 3e-49 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1)
Lus10036658 158 / 2e-48 AT1G18980 229 / 3e-76 RmlC-like cupins superfamily protein (.1)
Lus10034254 157 / 2e-48 AT5G39160 251 / 6e-85 RmlC-like cupins superfamily protein (.1.2.3)
Lus10032016 155 / 2e-47 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3)
Lus10035279 154 / 5e-47 AT5G39160 244 / 2e-82 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF07883 Cupin_2 Cupin domain
Representative CDS sequence
>Potri.008G020800.1 pacid=42806096 polypeptide=Potri.008G020800.1.p locus=Potri.008G020800 ID=Potri.008G020800.1.v4.1 annot-version=v4.1
ATGTCCTTAACGGTGACAGTCTTATTTGCCGTTCTTCTTCATGGCTGTGTCACCTTGGCTTCTGACCCCGATCCCGTCCGTGACTTCTGCATAGCCAATA
CAGATTCCGCAACCAACATCCCATGCAAGAATTCATCAGATGCCACTGTAGAGGATTTCATATTTTCTGGGATTAAATCTCATGGGAAATTCAGCAAAAC
CGGGCTAGCATCCATCCCTGTCAATGTGAATAACTTCCCATGCCTAAACACTCTAGGTGTGTCGCTTGTTCGTGCAGATTTTGAAGCTGGTGGTGTCAAC
GTGCCTCATTTCCATCCAAGAGCAACAGAGGTTGCATATGTGCTTGAGGGGAAAATTTATTCAGGGTTCGTCGATACACAGAACAGAGTTTTTGCTAAGG
TGCTTGAAAAAGGTGAAGTCATGGTGTTTCCAAGGGGGCTAGTTCACTTCCAAATGAATGTTGGAGATAAACCAGCAACTATCCTGGGCAGTTTTAATAG
CGAAAATCCAGGATTGATGAGGATTCCAACTGCAGTTTTCGGATGTGGAATCAAGGAAGAGCTTTTGGAGAAGGCTTTTGGTTTGAGTGTTAAGGACATC
TCCAAGGTGAGGAAAAACTTACATTTGTGTTAG
AA sequence
>Potri.008G020800.1 pacid=42806096 polypeptide=Potri.008G020800.1.p locus=Potri.008G020800 ID=Potri.008G020800.1.v4.1 annot-version=v4.1
MSLTVTVLFAVLLHGCVTLASDPDPVRDFCIANTDSATNIPCKNSSDATVEDFIFSGIKSHGKFSKTGLASIPVNVNNFPCLNTLGVSLVRADFEAGGVN
VPHFHPRATEVAYVLEGKIYSGFVDTQNRVFAKVLEKGEVMVFPRGLVHFQMNVGDKPATILGSFNSENPGLMRIPTAVFGCGIKEELLEKAFGLSVKDI
SKVRKNLHLC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G10080 RmlC-like cupins superfamily p... Potri.008G020800 0 1
AT5G65840 Thioredoxin superfamily protei... Potri.007G007201 10.24 0.7338
AT2G23240 AtMT4b Arabidopsis thaliana metalloth... Potri.009G167700 11.48 0.7063
AT3G59140 ATMRP14, ABCC10 ATP-binding cassette C10, mult... Potri.003G135701 12.96 0.7040
AT1G15260 unknown protein Potri.003G053600 15.49 0.6164
AT4G02160 unknown protein Potri.002G199100 16.70 0.6829
AT3G59580 NLP9 Plant regulator RWP-RK family ... Potri.016G026801 22.27 0.5388
AT1G75220 AtERDL6 ERD6-like 6, Major facilitator... Potri.005G122550 22.97 0.6684
AT3G07130 ATPAP15, PAP15 purple acid phosphatase 15 (.1... Potri.017G055800 24.18 0.6666
AT5G01075 Glycosyl hydrolase family 35 p... Potri.014G017600 25.88 0.6758
AT3G27120 P-loop containing nucleoside t... Potri.001G331300 32.72 0.6470

Potri.008G020800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.