Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74300 64 / 4e-13 alpha/beta-Hydrolases superfamily protein (.1) AT1G74290 62 / 1e-12 alpha/beta-Hydrolases superfamily protein (.1) AT1G74280 62 / 1e-12 alpha/beta-Hydrolases superfamily protein (.1) AT2G36290 62 / 1e-12 alpha/beta-Hydrolases superfamily protein (.1) AT1G08310 62 / 2e-12 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G48410 62 / 2e-12 alpha/beta-Hydrolases superfamily protein (.1) AT5G22460 60 / 6e-12 alpha/beta-Hydrolases superfamily protein (.1.2) AT3G54240 57 / 8e-11 alpha/beta-Hydrolases superfamily protein (.1) AT3G03230 54 / 1e-09 alpha/beta-Hydrolases superfamily protein (.1) AT3G44510 52 / 6e-09 alpha/beta-Hydrolases superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G237800 [exp] 104 / 3e-28 AT2G36290 436 / 1e-153 alpha/beta-Hydrolases superfamily protein (.1) Potri.008G021200 [exp] 103 / 9e-28 AT2G36290 433 / 1e-152 alpha/beta-Hydrolases superfamily protein (.1) Potri.008G021400 [exp] 100 / 1e-26 AT2G36290 446 / 2e-157 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G237700 [exp] 89 / 1e-22 AT2G36290 452 / 6e-160 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G164900 [exp] 59 / 2e-11 AT5G22460 374 / 1e-129 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.009G164600 [exp] 58 / 4e-11 AT3G44510 440 / 5e-156 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.004G203700 [exp] 56 / 3e-10 AT5G22460 434 / 2e-153 alpha/beta-Hydrolases superfamily protein (.1.2) Potri.006G131300 [exp] 43 / 8e-06 AT5G02970 658 / 0.0 alpha/beta-Hydrolases superfamily protein (.1) Potri.016G086200 [exp] 41 / 4e-05 AT5G02970 653 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028853 [exp] 74 / 2e-18 AT1G74300 140 / 2e-41 alpha/beta-Hydrolases superfamily protein (.1) Lus10008968 [exp] 74 / 7e-17 AT2G36290 442 / 5e-156 alpha/beta-Hydrolases superfamily protein (.1) Lus10018549 [exp] 73 / 2e-16 AT2G36290 434 / 8e-153 alpha/beta-Hydrolases superfamily protein (.1) Lus10039775 [exp] 72 / 6e-16 AT2G36290 425 / 3e-149 alpha/beta-Hydrolases superfamily protein (.1) Lus10043437 [exp] 68 / 1e-14 AT2G36290 429 / 5e-151 alpha/beta-Hydrolases superfamily protein (.1) Lus10041666 [exp] 68 / 2e-14 AT2G36290 440 / 2e-153 alpha/beta-Hydrolases superfamily protein (.1) Lus10034148 [exp] 65 / 1e-13 AT2G36290 436 / 1e-153 alpha/beta-Hydrolases superfamily protein (.1) Lus10028860 [exp] 65 / 1e-13 AT2G36290 433 / 1e-152 alpha/beta-Hydrolases superfamily protein (.1) Lus10008960 [exp] 64 / 4e-13 AT2G36290 353 / 8e-122 alpha/beta-Hydrolases superfamily protein (.1) Lus10020604 [exp] 57 / 1e-11 AT5G22460 133 / 5e-39 alpha/beta-Hydrolases superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G021301.1 pacid=42806273 polypeptide=Potri.008G021301.1.p locus=Potri.008G021301 ID=Potri.008G021301.1.v4.1 annot-version=v4.1 ATGATCAAGGAGATTACGGTGGTTTTGTGTCTGGGGTTGGCTGTATGGGCATATCAGGCCACCCAACCTCCACCTCCAAAGATTTATGGTGGCCCTCCTA TTACAGCGTCAAGAGAAAAACTGAGGGATGGGAGGCATTTAGCCTACAAGGAGCATGGTGTTTCTAGCGAATCTGCCAACTATAAGATCATCATTGTTCA TGGTTTCGCCTCCACGAAACATGATACAATGTTTCTAACGAACATGATTCCAGTACATCATTTCTATATCTATCTTCTTATTTGGCTGCTTGTTTTTCCC TCCTGA
AA sequence Show only first row Show all	>Potri.008G021301.1 pacid=42806273 polypeptide=Potri.008G021301.1.p locus=Potri.008G021301 ID=Potri.008G021301.1.v4.1 annot-version=v4.1 MIKEITVVLCLGLAVWAYQATQPPPPKIYGGPPITASREKLRDGRHLAYKEHGVSSESANYKIIIVHGFASTKHDTMFLTNMIPVHHFYIYLLIWLLVFP S

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G74300			alpha/beta-Hydrolases superfam...		Potri.008G021301 [exp]	0	1
AT2G28120			Major facilitator superfamily ...		Potri.001G194500 [exp]	15.00	0.6419
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.003G211532 [exp]	18.27	0.6534
AT3G06880			Transducin/WD40 repeat-like su...		Potri.008G220800 [exp]	32.98	0.6362
AT5G49525			unknown protein		Potri.008G102400 [exp]	94.36	0.5483
AT3G53510		ABCG20	ATP-binding cassette G20, ABC-...		Potri.006G215100 [exp]	119.37	0.5190
AT5G07300		BON2	BONZAI 2, Calcium-dependent ph...		Potri.003G055501 [exp]	141.42	0.5052
AT4G35280	C2H2ZnF	DAZ2	DUO1-ACTIVATED ZINC FINGER 2, ...		Potri.009G166200 [exp]	144.44	0.5043
AT2G39980			HXXXD-type acyl-transferase fa...		Potri.008G065000 [exp]	156.07	0.5301
AT3G16770	AP2_ERF	RAP2.03, ATEBP,...	RELATED TO AP2 3, ETHYLENE RES...		Potri.008G210900 [exp]	197.61	0.5106	Pt-RAP2.4,ERF35

Compare expression of checked genes

Potri.008G021301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.