Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52770 52 / 1e-10 ZPR3 LITTLE ZIPPER 3, protein binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G237600 [exp] 79 / 2e-21 AT3G52770 49 / 7e-10 LITTLE ZIPPER 3, protein binding (.1) Potri.006G083201 [exp] 58 / 3e-12 AT3G52770 54 / 2e-10 LITTLE ZIPPER 3, protein binding (.1) Potri.002G149600 [exp] 37 / 0.0002 AT3G60890 65 / 1e-14 LITTLE ZIPPER 2, protein binding (.1.2) Potri.014G071200 [exp] 36 / 0.0002 AT3G60890 62 / 1e-13 LITTLE ZIPPER 2, protein binding (.1.2) Potri.003G117200 [exp] 35 / 0.0004 AT3G60890 63 / 4e-14 LITTLE ZIPPER 2, protein binding (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021375 [exp] 57 / 2e-12 AT3G52770 77 / 3e-20 LITTLE ZIPPER 3, protein binding (.1) Lus10017055 [exp] 56 / 4e-12 AT3G52770 77 / 5e-20 LITTLE ZIPPER 3, protein binding (.1) Lus10022725 [exp] 55 / 5e-12 AT3G52770 73 / 5e-19 LITTLE ZIPPER 3, protein binding (.1) Lus10014188 [exp] 54 / 1e-11 AT3G52770 72 / 1e-18 LITTLE ZIPPER 3, protein binding (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.008G021766.2 pacid=42807651 polypeptide=Potri.008G021766.2.p locus=Potri.008G021766 ID=Potri.008G021766.2.v4.1 annot-version=v4.1 ATGGAAAAGCTAAACTCACAGCTATACTTGCAGAACTGTTATATAATCCAACAGAATGAGATGCTAAGGAAGAAAGCTCAACGGCTAAACCAGGAGAATC AGGCGCTGCTGTCCGAGCTGAAGAAGAAACTTTCCAGCGCAAGCTCTAGTTCTACAACAAATCCTGTCAAATCAAACAAGACCTAA
AA sequence Show only first row Show all	>Potri.008G021766.2 pacid=42807651 polypeptide=Potri.008G021766.2.p locus=Potri.008G021766 ID=Potri.008G021766.2.v4.1 annot-version=v4.1 MEKLNSQLYLQNCYIIQQNEMLRKKAQRLNQENQALLSELKKKLSSASSSSTTNPVKSNKT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52770		ZPR3	LITTLE ZIPPER 3, protein bindi...		Potri.008G021766 [exp]	0	1
AT2G28085			SAUR-like auxin-responsive pro...		Potri.010G226400 [exp]	9.94	0.7440	SAUR65
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006800 [exp]	14.76	0.8694
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006750 [exp]	17.49	0.8681
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177501 [exp]	20.29	0.8678
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006901 [exp]	26.60	0.8661
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Potri.014G088000 [exp]	26.98	0.8608	Pt-FRO1.1
					Potri.005G098650 [exp]	34.78	0.7283
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181100 [exp]	35.62	0.8594	Pt-NRAMP1.4
AT4G19690		ATIRT1, IRT1	ARABIDOPSIS IRON-REGULATED TRA...		Potri.015G117900 [exp]	36.33	0.8588	Pt-ZIP6.4
AT3G12900			2-oxoglutarate (2OG) and Fe(II...		Potri.005G097900 [exp]	39.24	0.8585

Compare expression of checked genes

Potri.008G021766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.