Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14540 213 / 5e-70 Peroxidase superfamily protein (.1) AT1G14550 199 / 9e-65 Peroxidase superfamily protein (.1) AT5G05340 188 / 2e-60 Peroxidase superfamily protein (.1) AT5G58400 161 / 7e-50 Peroxidase superfamily protein (.1) AT5G58390 151 / 5e-46 Peroxidase superfamily protein (.1) AT4G36430 138 / 9e-41 Peroxidase superfamily protein (.1) AT5G66390 132 / 1e-38 Peroxidase superfamily protein (.1) AT2G18140 132 / 2e-38 Peroxidase superfamily protein (.1) AT2G18150 130 / 1e-37 Peroxidase superfamily protein (.1) AT5G06720 125 / 6e-36 ATPA2 peroxidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G022232 [exp] 273 / 6e-94 AT1G14550 401 / 6e-141 Peroxidase superfamily protein (.1) Potri.008G022501 [exp] 273 / 6e-94 AT1G14550 434 / 3e-154 Peroxidase superfamily protein (.1) Potri.008G022248 [exp] 273 / 7e-94 AT1G14540 404 / 3e-142 Peroxidase superfamily protein (.1) Potri.008G022700 [exp] 271 / 5e-93 AT1G14540 404 / 4e-142 Peroxidase superfamily protein (.1) Potri.010G236870 [exp] 249 / 3e-84 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1) Potri.010G236890 [exp] 249 / 3e-84 AT1G14550 417 / 3e-147 Peroxidase superfamily protein (.1) Potri.010G236900 [exp] 247 / 2e-83 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1) Potri.010G236850 [exp] 242 / 2e-81 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1) Potri.010G236910 [exp] 242 / 2e-81 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009902 [exp] 219 / 1e-72 AT1G14550 441 / 8e-157 Peroxidase superfamily protein (.1) Lus10009898 [exp] 219 / 3e-72 AT1G14550 448 / 1e-159 Peroxidase superfamily protein (.1) Lus10024208 [exp] 219 / 3e-72 AT1G14550 442 / 3e-157 Peroxidase superfamily protein (.1) Lus10009900 [exp] 218 / 4e-72 AT1G14550 436 / 1e-154 Peroxidase superfamily protein (.1) Lus10024205 [exp] 194 / 6e-65 AT1G14550 212 / 3e-69 Peroxidase superfamily protein (.1) Lus10024209 [exp] 196 / 5e-63 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1) Lus10024207 [exp] 181 / 6e-58 AT1G14550 322 / 2e-110 Peroxidase superfamily protein (.1) Lus10009933 [exp] 181 / 2e-57 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1) Lus10030148 [exp] 180 / 2e-57 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1) Lus10009899 [exp] 179 / 1e-56 AT1G14550 367 / 2e-127 Peroxidase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0617 [poplar] [flax] Peroxidase PF00141 [poplar] [flax] peroxidase Peroxidase
Representative CDS sequence Show only first row Show all	>Potri.008G022264.1 pacid=42805781 polypeptide=Potri.008G022264.1.p locus=Potri.008G022264 ID=Potri.008G022264.1.v4.1 annot-version=v4.1 ATGGTTGCCTTGTCAGGTTCACATACTCTCGGACAAGCTCAATGCTTCACTTTCCGTGAAAGGATATACAATCACAGCAATATCGATGCCGGATTCGCTA GCACCCGCAGGAGGCGCTGTCCACGTGTTGGCAGCGACGCAACCTTAGCCCCGCTCGATTTGGTCACTCCCAATTCTTTCGACAACAATTACTTCAAGAA TCTGATGCAAAACAAGGGTCTCCTTCAATCAGATCAAGTGCTTTTCAATGGAGGCTCCACGGACAGCATTGTCTCTGAATACAGCAGGAACCCCGCAAGA TTCAGATCTGATTTTGGATCTGCCATGATCAAAATGGGAGATATAGGTCTTCTCACTGGATCTTCCGGGCAGATAAGGAGGATTTGCAGTGCTGTCAACT AG
AA sequence Show only first row Show all	>Potri.008G022264.1 pacid=42805781 polypeptide=Potri.008G022264.1.p locus=Potri.008G022264 ID=Potri.008G022264.1.v4.1 annot-version=v4.1 MVALSGSHTLGQAQCFTFRERIYNHSNIDAGFASTRRRRCPRVGSDATLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDSIVSEYSRNPAR FRSDFGSAMIKMGDIGLLTGSSGQIRRICSAVN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14540			Peroxidase superfamily protein...		Potri.008G022264 [exp]	0	1
AT3G50590			Transducin/WD40 repeat-like su...		Potri.005G136300 [exp]	6.00	0.9251
AT5G37600		ATGLN1;1, GLN1;...	ARABIDOPSIS THALIANA GLUTAMINE...		Potri.007G069600 [exp]	6.24	0.8702
AT5G35570			O-fucosyltransferase family pr...		Potri.006G142400 [exp]	7.93	0.9040
AT4G17380		MSH4, ATMSH4	ARABIDOPSIS MUTS HOMOLOG 4, M...		Potri.001G156200 [exp]	8.36	0.8981
AT4G00290			Mechanosensitive ion channel p...		Potri.014G088200 [exp]	9.59	0.8824
AT1G57790			F-box family protein (.1)		Potri.012G106800 [exp]	11.31	0.9109
AT3G18670			Ankyrin repeat family protein ...		Potri.008G022900 [exp]	12.72	0.9059
AT5G47730			Sec14p-like phosphatidylinosit...		Potri.006G004000 [exp]	16.88	0.9079	Pt-SSH1.2
					Potri.004G071450 [exp]	17.54	0.8906
AT3G14470			NB-ARC domain-containing disea...		Potri.003G025904 [exp]	18.54	0.8685

Compare expression of checked genes

Potri.008G022264 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.