Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G06210 91 / 4e-24 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT1G73530 90 / 2e-23 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G27330 81 / 1e-20 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G13850 81 / 2e-20 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT2G37510 79 / 1e-19 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G20030 79 / 3e-19 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 78 / 4e-19 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT3G46020 76 / 1e-18 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G26420 79 / 2e-18 ATRZ-1A RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G022200 [exp] 273 / 8e-93 AT3G20930 427 / 3e-149 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G237200 [exp] 239 / 2e-79 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 94 / 9e-25 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G208500 [exp] 92 / 9e-25 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 79 / 3e-19 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G319900 [exp] 78 / 4e-19 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.012G061600 [exp] 80 / 5e-19 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.009G160300 [exp] 77 / 5e-19 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.015G057400 [exp] 80 / 6e-19 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027035 [exp] 181 / 9e-57 AT3G20930 360 / 8e-123 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10025573 [exp] 149 / 2e-42 AT3G20930 336 / 3e-109 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10026364 [exp] 89 / 4e-23 AT1G73530 112 / 6e-32 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023758 [exp] 86 / 8e-22 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 84 / 3e-21 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10016639 [exp] 78 / 7e-19 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10022551 [exp] 77 / 2e-18 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10032591 [exp] 77 / 2e-18 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10042293 [exp] 77 / 2e-18 AT1G73530 100 / 7e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10043158 [exp] 76 / 2e-18 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.008G022280.1 pacid=42808681 polypeptide=Potri.008G022280.1.p locus=Potri.008G022280 ID=Potri.008G022280.1.v4.1 annot-version=v4.1 ATGTTTTTAGGTGTCCCTGGTGTTTTATCTGTTCAGCCAGATAAGAATGTTGAGTCAGAAAACAAGGATTATGGAGGCGATCACATAATCAATTCAGCAG ATTCTTCGGAAGCAAGTCAGACAACTCCTGTAAAAACAAAGAAACTTTTTATTACTGGTCTGTCATTTTATACTTCTGAGAAAACCTTGCGCGCAGCATT TGAGGGCTTTGGTGAGCTTGTCGAAGTTAAAATAATAATGGACAAGATTTCTAAGAGGTCCAAGGGATATGCATTTGTAGAGTACACGACAGAGGAGGCT GCAAGTGCAGCCCTCAAGGAGATGAATGGCAAGATCATCAATGGTTGGATGATTGTTGTTGATGTTGCCAAAAGCAACCCACCAGGATACAGCAGGGGTC AACCAAGACCAACAGCCTGA
AA sequence Show only first row Show all	>Potri.008G022280.1 pacid=42808681 polypeptide=Potri.008G022280.1.p locus=Potri.008G022280 ID=Potri.008G022280.1.v4.1 annot-version=v4.1 MFLGVPGVLSVQPDKNVESENKDYGGDHIINSADSSEASQTTPVKTKKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFVEYTTEEA ASAALKEMNGKIINGWMIVVDVAKSNPPGYSRGQPRPTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G20930			RNA-binding (RRM/RBD/RNP motif...		Potri.008G022280 [exp]	0	1
AT3G20930			RNA-binding (RRM/RBD/RNP motif...		Potri.008G022200 [exp]	1.00	0.9866
AT1G70820			phosphoglucomutase, putative /...		Potri.008G131400 [exp]	3.46	0.9647
AT1G76430		PHT1;9	phosphate transporter 1;9 (.1)		Potri.002G005500 [exp]	3.46	0.9726	PtrPHT1-9
AT5G52780			Protein of unknown function (D...		Potri.004G072900 [exp]	4.47	0.9669
AT1G49380			cytochrome c biogenesis protei...		Potri.009G111692 [exp]	5.29	0.9689
AT5G05280			RING/U-box superfamily protein...		Potri.019G130100 [exp]	7.00	0.9645
AT1G04920		ATSPS3F	sucrose phosphate synthase 3F ...		Potri.017G057800 [exp]	7.61	0.9427
AT1G13940			Plant protein of unknown funct...		Potri.006G262600 [exp]	9.00	0.9533
AT4G24090			unknown protein		Potri.001G084500 [exp]	10.19	0.9628
AT1G53230	TCP	TCP3	TEOSINTE BRANCHED 1, cycloidea...		Potri.001G375800 [exp]	11.48	0.9529

Compare expression of checked genes

Potri.008G022280 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.