Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66240 124 / 1e-38 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT3G56240 120 / 4e-37 ATX1, CCH copper chaperone (.1) AT5G02600 69 / 1e-15 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT5G27690 66 / 3e-14 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 62 / 2e-13 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT2G37390 62 / 3e-13 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT2G18196 61 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 60 / 5e-13 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G06330 60 / 6e-13 Heavy metal transport/detoxification superfamily protein (.1) AT2G28660 61 / 8e-13 Chloroplast-targeted copper chaperone protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G236500 [exp] 129 / 5e-41 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.010G114600 [exp] 67 / 9e-16 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 66 / 3e-15 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G024800 [exp] 66 / 4e-15 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 64 / 1e-14 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G213900 [exp] 66 / 2e-14 AT2G37390 127 / 2e-35 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.016G080400 [exp] 66 / 3e-14 AT2G37390 133 / 2e-37 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.005G003700 [exp] 63 / 6e-14 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G234700 [exp] 64 / 7e-14 AT2G37390 114 / 2e-30 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043444 [exp] 119 / 1e-36 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3) Lus10028859 [exp] 113 / 2e-33 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3) Lus10034138 [exp] 105 / 2e-29 AT1G66240 115 / 1e-32 homolog of anti-oxidant 1 (.1.2.3) Lus10008963 [exp] 77 / 7e-19 AT1G66240 81 / 5e-20 homolog of anti-oxidant 1 (.1.2.3) Lus10024435 [exp] 71 / 7e-16 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10025294 [exp] 70 / 9e-16 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10033250 [exp] 63 / 1e-13 AT2G18196 251 / 3e-86 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 62 / 1e-13 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10008284 [exp] 62 / 2e-13 AT2G18196 246 / 4e-84 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 62 / 2e-13 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.008G023800.1 pacid=42808215 polypeptide=Potri.008G023800.1.p locus=Potri.008G023800 ID=Potri.008G023800.1.v4.1 annot-version=v4.1 ATGTCTCAGACTGTTGTCCTCAAGGTTGGCATGTCATGTGGAGGTTGTGTTGGGGCTGTGAAAAGGGTTTTGGGAAAAATGGAAGGTGTGGAATCATATG ACATTGATTTGAAGGAGCAAAAAGTCACAGTGAAAGGAAATGTGCAGCCAGATGCTGTTCTTCAGACTGTCTCTAAGACCGGGAAGAAGACTACCTTCTG GGAAGCAGAAGCACCAGCTGAACCTGCTACTGCAGAAACTTTGGCTGCTGCATAA
AA sequence Show only first row Show all	>Potri.008G023800.1 pacid=42808215 polypeptide=Potri.008G023800.1.p locus=Potri.008G023800 ID=Potri.008G023800.1.v4.1 annot-version=v4.1 MSQTVVLKVGMSCGGCVGAVKRVLGKMEGVESYDIDLKEQKVTVKGNVQPDAVLQTVSKTGKKTTFWEAEAPAEPATAETLAAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Potri.008G023800 [exp]	0	1
AT5G66390			Peroxidase superfamily protein...		Potri.007G019300 [exp]	3.31	0.8715
AT5G07050			nodulin MtN21 /EamA-like trans...		Potri.012G007700 [exp]	7.74	0.8388
					Potri.012G028432 [exp]	7.93	0.8550
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Potri.004G002500 [exp]	8.48	0.7170
AT1G70560		CKRC1, WEI8, TA...	WEAK ETHYLENE INSENSITIVE 8, S...		Potri.010G044500 [exp]	9.74	0.8374
AT5G51100		FSD2	Fe superoxide dismutase 2 (.1)		Potri.015G110400 [exp]	10.19	0.8071
AT2G46570		LAC6	laccase 6 (.1)		Potri.014G100600 [exp]	11.48	0.8254
AT5G53550		ATYSL3, YSL3	YELLOW STRIPE like 3 (.1.2)		Potri.012G027800 [exp]	12.40	0.8097
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Potri.003G119700 [exp]	14.56	0.6380
AT4G18380			F-box family protein (.1.2)		Potri.003G203500 [exp]	15.90	0.7684

Compare expression of checked genes

Potri.008G023800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.