Plant FIBer expression Database

Potri.008G024601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36355 37 / 0.0001 Family of unknown function (DUF662) (.1), Family of unknown function (DUF662) (.2), Family of unknown function (DUF662) (.3)
AT2G27740 37 / 0.0002 Family of unknown function (DUF662) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G235600
[exp]
49 / 6e-09 AT3G09980 128 / 3e-38 Family of unknown function (DUF662) (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.008G024601.1 pacid=42805808 polypeptide=Potri.008G024601.1.p locus=Potri.008G024601 ID=Potri.008G024601.1.v4.1 annot-version=v4.1
ATGTTGCGATTGTACTTAAGAAGAATATTGTACATGGCAAATAGAGAGTTGAAACGGCCTCTAGGTCAGAGCTGCCAAAAGAAGCTGCTGACTGAGAGTG
AAAGACAAAGGATGATGAAGCTGGAAGAACTGAACAAGATTATCTCTGCCTTCTATGATCTCACTGCGAGATATTGTATTCATTACGTACTGATTTTTCC
ATAA
AA sequence
>Potri.008G024601.1 pacid=42805808 polypeptide=Potri.008G024601.1.p locus=Potri.008G024601 ID=Potri.008G024601.1.v4.1 annot-version=v4.1
MLRLYLRRILYMANRELKRPLGQSCQKKLLTESERQRMMKLEELNKIISAFYDLTARYCIHYVLIFP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.008G024601
[exp]
0 1
AT3G20020 ATPRMT6 ARABIDOPSIS THALIANA PROTEIN A... Potri.014G004000
[exp]
4.89 0.8810
AT2G27110 FAR1_related FRS3 FAR1-related sequence 3 (.1.2.... Potri.012G097200
[exp]
10.67 0.8750
AT3G55920 Cyclophilin-like peptidyl-prol... Potri.010G189000
[exp]
11.40 0.8381
AT5G24130 unknown protein Potri.015G021100
[exp]
14.14 0.9030
AT1G30825 DIS2, ARPC2, AR... DISTORTED TRICHOMES 2, ACTIN-R... Potri.001G073300
[exp]
14.56 0.7441 Pt-ARPC2.2
AT5G22820 ARM repeat superfamily protein... Potri.009G151100
[exp]
16.43 0.7854
AT5G62960 unknown protein Potri.012G082400
[exp]
21.63 0.7975
Potri.008G206733
[exp]
22.91 0.8741
AT4G22790 MATE efflux family protein (.1... Potri.001G115400
[exp]
23.87 0.8168
AT4G05120 FUR1, ENT3, FLU... FUDR RESISTANT 1, EQUILIBRATIV... Potri.019G118400
[exp]
25.03 0.8836

Potri.008G024601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.