Potri.008G025700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G40045 84 / 4e-21 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G234900 164 / 2e-52 AT4G40045 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034155 75 / 2e-17 AT4G40045 99 / 4e-27 unknown protein
Lus10043427 74 / 3e-17 AT4G40045 99 / 4e-27 unknown protein
PFAM info
Representative CDS sequence
>Potri.008G025700.1 pacid=42807424 polypeptide=Potri.008G025700.1.p locus=Potri.008G025700 ID=Potri.008G025700.1.v4.1 annot-version=v4.1
ATGGACAAAATGATAGGGCTCAATTCTTTCTTACACCCTAAAATCCCATCATCTTCAAGAATCCCTCTTCTCCACATCCAACCCAACCTCCCTCTCCCTT
CTTTTCCTCTCAAAATCTCCAAGAAAACCCATCTGAGATTCCTTCTTTCTGCGCAAACCAACAGCAACAACCCAACTCAAGAACCCAAAGAACCAGCACA
AGAAATGAATTATGAGTCTTCCAATAACAATGGTGGTGGTGGTGGTGGTTTGAATAAAGATCAACCTCCCCCTTTAATCAATATCAAGTGGGGTGATTTA
TTACTGAACCCAAATCCTGATAACATCTTGGCTGTTGGATTGACTGGTTTGCTTACATGGGCCAGTGTTCAAGTTCTTTGGCAGCTTTTCTTTATCTCTT
TAGTCATTCTTGTTGCTGCTCTTAAGTACTCTTTTATTGCTGCTCTCCTTATTTTCATCCTCGTTACTCTTCTTTAA
AA sequence
>Potri.008G025700.1 pacid=42807424 polypeptide=Potri.008G025700.1.p locus=Potri.008G025700 ID=Potri.008G025700.1.v4.1 annot-version=v4.1
MDKMIGLNSFLHPKIPSSSRIPLLHIQPNLPLPSFPLKISKKTHLRFLLSAQTNSNNPTQEPKEPAQEMNYESSNNNGGGGGGLNKDQPPPLINIKWGDL
LLNPNPDNILAVGLTGLLTWASVQVLWQLFFISLVILVAALKYSFIAALLIFILVTLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G40045 unknown protein Potri.008G025700 0 1
AT3G50810 Uncharacterised protein family... Potri.004G149332 2.64 0.8835
AT5G19485 transferases;nucleotidyltransf... Potri.009G066400 10.39 0.8719
AT1G28120 unknown protein Potri.001G067400 10.58 0.8733
AT5G13260 unknown protein Potri.003G164100 10.95 0.8905
AT3G12180 Cornichon family protein (.1) Potri.016G051000 12.84 0.8849
AT4G14010 RALFL32 ralf-like 32 (.1) Potri.001G321300 18.46 0.8569
AT2G30580 BMI1A, DRIP2 DREB2A-interacting protein 2 (... Potri.005G054100 19.59 0.8633
AT2G39550 GGB, ATGGT-IB, ... GERANYLGERANYLTRANSFERASE-I BE... Potri.008G054500 20.97 0.8797 Pt-ATGGT.1
AT1G66680 AR401 S-adenosyl-L-methionine-depend... Potri.012G068600 22.80 0.8803
Potri.005G097250 24.45 0.7760

Potri.008G025700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.