Potri.008G026100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3)
AT2G38025 67 / 1e-12 Cysteine proteinases superfamily protein (.1)
AT5G67170 48 / 6e-06 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 44 / 0.0001 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G234300 521 / 0 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G050900 206 / 8e-64 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3)
Potri.006G057400 197 / 2e-60 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G177400 187 / 3e-59 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G110400 72 / 9e-15 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
Potri.010G057750 46 / 1e-06 AT3G57810 52 / 1e-09 Cysteine proteinases superfamily protein (.1.2.3)
Potri.005G140500 47 / 1e-05 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.004G196800 47 / 2e-05 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Potri.009G160100 45 / 6e-05 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028840 289 / 2e-95 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3)
Lus10008986 280 / 2e-93 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
Lus10020438 206 / 4e-64 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3)
Lus10015803 185 / 3e-58 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3)
Lus10037002 183 / 1e-57 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3)
Lus10006255 46 / 3e-05 AT5G67170 363 / 7e-124 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Lus10005193 45 / 4e-05 AT2G27350 549 / 0.0 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Potri.008G026100.1 pacid=42807443 polypeptide=Potri.008G026100.1.p locus=Potri.008G026100 ID=Potri.008G026100.1.v4.1 annot-version=v4.1
ATGCTTGGTGTACTCTGCGCACGCCCCAAGCCTAACTGGATCCTCAACTCCCTCTTCACTCATTTCCACCATCAACACCACCACCACCAAAGCAACGACC
GCCTTTCTTTACACCTCCCCCATTCCTTCACCGCGGCTCGCCGCCACCACTCTAGCTTTTGCAGCGCTGATTGCGGCGGTGGAGGAGCGGCGGCGATATG
GCACGTGGTCCAGCCGGCGGATTGGCGGAGGAGGAGGGGGAGGAGGAGTGTGAGAGGGGAAGGTTCGTGGAACGTTGCGTGGGATGGGAGACCGGCGAGG
TGGCTCCACCGGCCTGATTCGGCTTGGTTGTTGTTCGGCGTTTGTGCTTGCCTTGCTCCGGCGATTGAGTTATTTTGTGACGTGAATATCGAGGGAGGTG
AAAATGTTGTCGTTGATGTTGATCATCAGGAGAAGGAGAGAATTGACGGTGGTGATTTGAATGCGAGTGCAGTGAATTCTGATGATGTGAAACAGGATAG
CAGTAGCTCTACTGCTGGTTCTGATTATAAAGTCACAGGGGTGCTGGCGGATGGCCGATGCCTGTTTAGAGCAATTGCTCATATGGCATGTTTGAGAAAT
GGAGAAGAGGCTCCTGATGAAAATCGTCAAAGAGAACTCGCAGATGAATTAAGAGCTCAAGTTGTGGATGAGCTTTTAAAGAGGCGGGAAGAAACCGAAT
GGTTTATTGAAGGAGATTTTGATGCATATGTCAAGAGAATTCAACAACCTTATGTATGGGGTGGAGAACCTGAGTTGTTGATGGCTTCTCATGTTTTAAA
GACAATGATATCAGTGTTCATGAGAGATAGGACAACGGGTAATTTGGTAAACATAGCAAATTACGGTGAAGAGTACCGGAAAGATGAAGTCAATCCCATT
AATGTGCTGTTTCATGGATATGGTCACTACGATATATTGGAGACAACCCCAGGTCAAAGTTACAAGAAAGTGGACTTGTAG
AA sequence
>Potri.008G026100.1 pacid=42807443 polypeptide=Potri.008G026100.1.p locus=Potri.008G026100 ID=Potri.008G026100.1.v4.1 annot-version=v4.1
MLGVLCARPKPNWILNSLFTHFHHQHHHHQSNDRLSLHLPHSFTAARRHHSSFCSADCGGGGAAAIWHVVQPADWRRRRGRRSVRGEGSWNVAWDGRPAR
WLHRPDSAWLLFGVCACLAPAIELFCDVNIEGGENVVVDVDHQEKERIDGGDLNASAVNSDDVKQDSSSSTAGSDYKVTGVLADGRCLFRAIAHMACLRN
GEEAPDENRQRELADELRAQVVDELLKRREETEWFIEGDFDAYVKRIQQPYVWGGEPELLMASHVLKTMISVFMRDRTTGNLVNIANYGEEYRKDEVNPI
NVLFHGYGHYDILETTPGQSYKKVDL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G57810 Cysteine proteinases superfami... Potri.008G026100 0 1
AT4G22920 ATNYE1, SGR1, S... non-yellowing 1 (.1) Potri.003G119600 1.73 0.9470
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Potri.005G181600 3.00 0.9219
AT1G75290 NAD(P)-binding Rossmann-fold s... Potri.008G116500 3.46 0.9157
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056366 6.92 0.9181
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G055900 7.07 0.9231
AT2G29670 Tetratricopeptide repeat (TPR)... Potri.010G191600 7.34 0.8903
AT2G20890 PSB29, THF1 THYLAKOID FORMATION1, photosys... Potri.013G148400 8.36 0.9159
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056258 8.77 0.9129
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056316 10.39 0.9077
AT5G45890 SAG12 senescence-associated gene 12 ... Potri.004G056100 10.48 0.9060

Potri.008G026100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.